>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, as well as, the second and fourth, of four, ACT domains present in cyanobacteria AK. Also included are the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase isoenzyme AKI found in Bacilli (B. subtilis strain 168), Clostridia, and Actinobacteria bacterial species. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=98.05 E-value=3.2e-06 Score=61.74 Aligned_cols=58 Identities=41% Similarity=0.646 Sum_probs=50.1 Q ss_pred HCC--CCCCCCCCCCCHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHH Q ss_conf 012--7750004841000145541285011123443222233310121230247766887898886 Q gi|254780873|r 269 ISL--RRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKE 332 (411) Q Consensus 269 Iti--~~~~~~~g~~a~If~~La~~~I~VdmI~qs~s~~~~~~~Isf~i~~~d~~~~~~~L~~~~~ 332 (411) T Consensus 3 isvvG~Gm~~~~Gvaarif~aL~~~~Inv~~iss--SE----~~Is~vV~~~d~~~Av~aLh~~F~ 62 (63) T cd04923 3 VSIVGAGMRSHPGVAAKMFKALAEAGINIEMIST--SE----IKISCLVDEDDAEKAVRALHEAFE 62 (63) T ss_pred EEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEEC--CC----CEEEEEEEHHHHHHHHHHHHHHHC T ss_conf 9998888478943999999999987998799982--56----779999808999999999998718

HHsearch alignment for GI: 254780873 and conserved domain: cd04923