>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). Included in this CD is the second of two ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). The first or N-terminal ACT domain of these proteins cluster with the ThrA-like ACT 1 domains (ACT_AKi-HSDH-ThrA-like_1) which includes the threonine-sensitive archaeal Methanococcus jannaschii aspartokinase ACT 1 domain. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=99.70 E-value=6.9e-17 Score=133.61 Aligned_cols=64 Identities=33% Similarity=0.542 Sum_probs=62.4 Q ss_pred EEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEE--ECCCEEEEEECHHHHHHHHHHHHHHCCC Q ss_conf 169999667866785579999999986798299997--0784899997088999999999987097 Q gi|254780873|r 345 LVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAIT--TSEIKISVLIDSAYTELAVRSLHSCYGL 408 (411) Q Consensus 345 ~a~ISvVG~gm~~~~Giaakif~aL~~~~InI~~is--sSe~~IS~VV~~~d~~~Av~~LH~~F~l 408 (411) T Consensus 1 ia~isvvG~gM~~~~GvaariF~aLa~~~INI~mIsQgsSE~sIs~~V~~~d~~~Av~alh~eF~L 66 (66) T cd04924 1 VAVVAVVGSGMRGTPGVAGRVFGALGKAGINVIMISQGSSEYNISFVVAEDDGWAAVKAVHDEFGL 66 (66) T ss_pred CEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCEEEEEECHHHHHHHHHHHHHHHCC T ss_conf 949999788847896779999999997799789997377630799999489999999999987288

HHsearch alignment for GI: 254780873 and conserved domain: cd04924