RPSBLAST alignment for GI: 254780873 and conserved domain: cd04916
>gnl|CDD|153188 cd04916, ACT_AKiii-YclM-BS_2, ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. B. subtilis YclM is reported to be a single polypeptide of 50 kD. AKIII from B. subtilis strain 168 is induced by lysine and repressed by threonine and it is synergistically inhibited by lysine and threonine. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 66
Score = 43.0 bits (102), Expect = 2e-04
Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
Query: 272 RRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVL 327
+++ G+SA + LA+A INI MI Q SE + I + +KA+ +
Sbjct: 9 EGMKNTVGVSARATAALAKAGINIRMINQGSSE----ISIMIGVHNEDADKAVKAI 60