HHsearch alignment for GI: 254780875 and conserved domain: COG1568

>COG1568 Predicted methyltransferases [General function prediction only].
Probab=96.20  E-value=0.017  Score=36.86  Aligned_cols=167  Identities=17%  Similarity=0.148  Sum_probs=95.1

Q ss_pred             HHHHHHHHHHHCCCHHHHHH-CCCCCCCHHHHHHHHHHHHH-----H--------HCCCCHHHHCCCEEEEEEEEEEECC
Q ss_conf             89999999983899989850-44885898999999999998-----9--------7498376853631442376775046
Q gi|254780875|r    5 RDSHSFLCRVTGLSSHQVIV-DPDSVLDDRQRFFLTNAIVR-----S--------LKHESIHRILGWRDFYNVRLTLSSD   70 (264)
Q Consensus         5 ~dA~~Ll~~~l~~~~~~l~~-~~~~~l~~~~~~~l~~~i~r-----r--------~~g~Pl~YIlg~~~F~~~~f~v~~~   70 (264)
T Consensus        22 R~Ve~vl~ail~~~d~wkIvd~s~~plp--~v~~i~~~l~~egiv~~~~g~v~~TekG~E~~e~~gi~~~~~~~C~~CeG   99 (354)
T COG1568          22 RSVENVLSAILATNDFWKIVDYSDLPLP--LVASILEILEDEGIVKIEEGGVELTEKGEELAEELGIKKKYDYTCECCEG   99 (354)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCCCCH--HHHHHHHHHHHCCCEEEECCCEEEHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             8999999999747527757653158726--89999999986681898548476426269999984877466641466568


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCC--------------------------CCCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             205122356555310123321101--------------------------246860566421421123312222333210
Q gi|254780875|r   71 TFEPRPETELLVDSALAFSLPRIE--------------------------KRDVVRILDLGTGTGAVCLALLKESPFFKG  124 (264)
Q Consensus        71 vLIPRpeTE~lv~~~l~~~~~~~~--------------------------~~~~~~vLDlG~GsG~i~i~la~~~~~~~v  124 (264)
T Consensus       100 rgi~l~~f~dll~kf~eiaK~RP~p~~~yDQgfvTpEttv~Rv~lm~~RGDL~gK~I~vvG-DDDLtsia~aLt~mpk~i  178 (354)
T COG1568         100 RGISLQAFKDLLEKFREIAKDRPEPLHQYDQGFVTPETTVSRVALMYSRGDLEGKEIFVVG-DDDLTSIALALTGMPKRI  178 (354)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCEEEEEEEECCCCCCCCCEEEEEC-CCHHHHHHHHHCCCCCEE
T ss_conf             6503531899999999998449986100135645753101344321104675787689970-750657889863887337


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCC----CHHHHHHHCCHHH
Q ss_conf             01333222002444201100012222222222222221----0023332011333
Q gi|254780875|r  125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE----GLFDVIVSNPPYI  175 (264)
Q Consensus       125 ~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~~----~~fD~IvsNPPYI  175 (264)
T Consensus       179 aVvDIDERli~fi~k~aee~g~~-~ie~~~~Dlr~plpe~~~~kFDvfiTDPpeT  232 (354)
T COG1568         179 AVVDIDERLIKFIEKVAEELGYN-NIEAFVFDLRNPLPEDLKRKFDVFITDPPET  232 (354)
T ss_pred             EEEECHHHHHHHHHHHHHHHCCC-CHHHEEEHHCCCCHHHHHHHCCEEECCCHHH
T ss_conf             99831589999999999984833-1554030510458398885077643596335