HHsearch alignment for GI: 254780875 and conserved domain: COG1867

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis].
Probab=97.66  E-value=3.5e-05  Score=54.58  Aligned_cols=81  Identities=30%  Similarity=0.369  Sum_probs=63.2

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC---CCHHHHHHHCC--
Q ss_conf             8605664214211233122223332100133322200244420110001222222222222222---10023332011--
Q gi|254780875|r   98 VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNP--  172 (264)
Q Consensus        98 ~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~---~~~fD~IvsNP--  172 (264)
T Consensus        53 ~~~v~DalsatGiRgIRya~E~~~~~v~lNDisp~Avelik~Nv~~N~~~~-~~v~n~DAN~lm~~~~~~fd~IDiDPFG  131 (380)
T COG1867          53 PKRVLDALSATGIRGIRYAVETGVVKVVLNDISPKAVELIKENVRLNSGED-AEVINKDANALLHELHRAFDVIDIDPFG  131 (380)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCC-CEEECCHHHHHHHHCCCCCCEEECCCCC
T ss_conf             738864355533667545342576179971589899999999998347666-3255342899987258876378138999


Q ss_pred             ---HHHHHHC
Q ss_conf             ---3332100
Q gi|254780875|r  173 ---PYIESVI  179 (264)
Q Consensus       173 ---PYI~~~~  179 (264)
T Consensus       132 SPaPFlDaA~  141 (380)
T COG1867         132 SPAPFLDAAL  141 (380)
T ss_pred             CCCHHHHHHH
T ss_conf             9726799999