HHsearch alignment for GI: 254780875 and conserved domain: COG2230

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].
Probab=99.29  E-value=2e-12  Score=102.23  Aligned_cols=141  Identities=22%  Similarity=0.287  Sum_probs=104.1

Q ss_pred             HCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             53631442376775046205122356555310123321101246860566421421123312222333210013332220
Q gi|254780875|r   54 ILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA  133 (264)
Q Consensus        54 Ilg~~~F~~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~a  133 (264)
T Consensus        34 ~Ld~~~~Yscayf~~~~~---tL~eAQ~--~k~~~~~~kl~L~~G~~lLDiGCGWG~l~~~aA~~y-~v~V~GvTlS~~Q  107 (283)
T COG2230          34 FLDPSMTYSCAYFEDPDM---TLEEAQR--AKLDLILEKLGLKPGMTLLDIGCGWGGLAIYAAEEY-GVTVVGVTLSEEQ  107 (283)
T ss_pred             HCCCCCCEEEEEECCCCC---CHHHHHH--HHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCEEEEEECCHHH
T ss_conf             628987624577579988---8589999--999999975699999989874788449999999984-9979996689999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             02444201100012222222222222221002333201133321001221111123575433210112321025689999
Q gi|254780875|r  134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGV  213 (264)
Q Consensus       134 l~~A~~N~~~~~~~~~i~~~~~d~~~~~~~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~  213 (264)
T Consensus       108 ~~~~~~r~~~~gl~~~v~v~l~d~rd-~~e~fDrIvS----v--gmfEhv------------------g~~~~~~ff~~~  162 (283)
T COG2230         108 LAYAEKRIAARGLEDNVEVRLQDYRD-FEEPFDRIVS----V--GMFEHV------------------GKENYDDFFKKV  162 (283)
T ss_pred             HHHHHHHHHHCCCCCCCEEEECCCCC-CCCCCCEEEE----H--HHHHHH------------------CCCCHHHHHHHH
T ss_conf             99999999975997660799656210-3243420556----0--068873------------------710289999999


Q ss_pred             HHHCCCCCEEEE
Q ss_conf             985378878999
Q gi|254780875|r  214 SRHLNKDGLCSV  225 (264)
Q Consensus       214 ~~~L~~~G~l~l  225 (264)
T Consensus       163 ~~~L~~~G~~ll  174 (283)
T COG2230         163 YALLKPGGRMLL  174 (283)
T ss_pred             HHHCCCCCEEEE
T ss_conf             964599965999