HHsearch alignment for GI: 254780875 and conserved domain: COG2520

>COG2520 Predicted methyltransferase [General function prediction only].
Probab=98.83  E-value=1.5e-08  Score=76.78  Aligned_cols=157  Identities=20%  Similarity=0.204  Sum_probs=107.8

Q ss_pred             EEEEEEEECC--CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             2376775046--20512235655531012332110124686056642142112331222233321001333222002444
Q gi|254780875|r   61 YNVRLTLSSD--TFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAK  138 (264)
Q Consensus        61 ~~~~f~v~~~--vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~  138 (264)
T Consensus       158 ~G~~f~vD~~Kv~Fsprl~~ER~Rv--a~~------v~~GE~V~DmFAGVGpfsi~~Ak~g~~~-V~A~diNP~A~~~L~  228 (341)
T COG2520         158 NGCRFKVDVAKVYFSPRLSTERARV--AEL------VKEGETVLDMFAGVGPFSIPIAKKGRPK-VYAIDINPDAVEYLK  228 (341)
T ss_pred             CCEEEEECHHHEEECCCCHHHHHHH--HHH------HCCCCEEEECCCCCCCCHHHHHHCCCCE-EEEEECCHHHHHHHH
T ss_conf             8889997247848778744789999--863------0699889983578654012466547863-999945989999999


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCC--CHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             201100012222222222222221--002333201133321001221111123575433210112321025689999985
Q gi|254780875|r  139 SNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH  216 (264)
Q Consensus       139 ~N~~~~~~~~~i~~~~~d~~~~~~--~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~  216 (264)
T Consensus       229 eNi~LN~v~~~v~~i~gD~rev~~~~~~aDrIim~~p~~-------------a-----------------~~fl~~A~~~  278 (341)
T COG2520         229 ENIRLNKVEGRVEPILGDAREVAPELGVADRIIMGLPKS-------------A-----------------HEFLPLALEL  278 (341)
T ss_pred             HHHHHCCCCCEEEEEECCHHHHHHCCCCCCEEEECCCCC-------------C-----------------HHHHHHHHHH
T ss_conf             999855765515679664888502046678898389872-------------0-----------------2338999998


Q ss_pred             CCCCCEEEE-EECCCH------HHHHHHHHHHCCCC----EEEEEECCCCC
Q ss_conf             378878999-817667------99999999978980----58998056899
Q gi|254780875|r  217 LNKDGLCSV-EIGYNQ------KVDVVRIFESRKLF----LVNAFKDYGGN  256 (264)
Q Consensus       217 L~~~G~l~l-Eig~~q------~~~v~~ll~~~gf~----~v~~~kD~~g~  256 (264)
T Consensus       279 ~k~~g~iHyy~~~~e~~~~~~~~~~i~~~~~~~~~~~~v~~~r~VksysP~  329 (341)
T COG2520         279 LKDGGIIHYYEFVPEDDIEERPEKRIKSAARKGGYKVEVLKVRRVKSYSPG  329 (341)
T ss_pred             HHCCCEEEEEECCCHHHCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCC
T ss_conf             514867999962243411112599999987643676327889993231897