HHsearch alignment for GI: 254780875 and conserved domain: COG3129

>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only].
Probab=98.62  E-value=2e-08  Score=75.89  Aligned_cols=118  Identities=26%  Similarity=0.418  Sum_probs=81.1

Q ss_pred             EEEEEE-EEEECCCCCH----HHHHHH-HHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             442376-7750462051----223565-5531012332110124686056642142112331222233321001333222
Q gi|254780875|r   59 DFYNVR-LTLSSDTFEP----RPETEL-LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCK  132 (264)
Q Consensus        59 ~F~~~~-f~v~~~vLIP----RpeTE~-lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~  132 (264)
T Consensus        36 ~fY~v~~wdiPeg~LCPpvPgRAdYih~laDL-L~s~~g~-~~~~~i~~LDIGvGAnCIYPliG~~eYgwrfvGseid~~  113 (292)
T COG3129          36 HFYAVRYWDIPEGFLCPPVPGRADYIHHLADL-LASTSGQ-IPGKNIRILDIGVGANCIYPLIGVHEYGWRFVGSEIDSQ  113 (292)
T ss_pred             HHCCEEEECCCCCCCCCCCCCHHHHHHHHHHH-HHHCCCC-CCCCCEEEEEECCCCCCCCCCCCCEEECCEEECCCCCHH
T ss_conf             74360475178877389999736799999999-8743898-776764788504576420021332121220015746877


Q ss_pred             CHHHHHHCCCCC-CCCCCCCCCCC-C---CCCCC---CCHHHHHHHCCHHHHHH
Q ss_conf             002444201100-01222222222-2---22222---10023332011333210
Q gi|254780875|r  133 ALEIAKSNAVTN-GVSERFDTLQS-D---WFSSV---EGLFDVIVSNPPYIESV  178 (264)
Q Consensus       133 al~~A~~N~~~~-~~~~~i~~~~~-d---~~~~~---~~~fD~IvsNPPYI~~~  178 (264)
T Consensus       114 sl~sAk~ii~~N~~l~~~I~lr~qk~~~~if~giig~nE~yd~tlCNPPFh~s~  167 (292)
T COG3129         114 SLSSAKAIISANPGLERAIRLRRQKDSDAIFNGIIGKNERYDATLCNPPFHDSA  167 (292)
T ss_pred             HHHHHHHHHHCCCCHHHHEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCCHHH
T ss_conf             888889998709041533367752685434165103443330575189830209