HHsearch alignment for GI: 254780875 and conserved domain: COG4122

>COG4122 Predicted O-methyltransferase [General function prediction only].
Probab=98.82  E-value=1.3e-09  Score=83.79  Aligned_cols=114  Identities=25%  Similarity=0.352  Sum_probs=92.5

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             235655531012332110124686056642142112331222233-3210013332220024442011000122222222
Q gi|254780875|r   76 PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP-FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQ  154 (264)
Q Consensus        76 peTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~-~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~  154 (264)
T Consensus        45 ~e~g~~L~~L~~~-------~~~k~iLEiGT~~GySal~mA~~l~~~g~l~tiE~~~e~~~~A~~n~~~ag~~~~i~~~~  117 (219)
T COG4122          45 PETGALLRLLARL-------SGPKRILEIGTAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAGVDDRIELLL  117 (219)
T ss_pred             HHHHHHHHHHHHH-------CCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             1489999999973-------498649996352379999999638889769997079899999999999759765289883


Q ss_pred             -CCCCCCC----CCHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             -2222222----1002333201133321001221111123575433210112321025689999985378878999
Q gi|254780875|r  155 -SDWFSSV----EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV  225 (264)
Q Consensus       155 -~d~~~~~----~~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l  225 (264)
T Consensus       118 ~gdal~~l~~~~~~~fDliF-----IDadK------------------------~~yp~~le~~~~lLr~GGliv~  164 (219)
T COG4122         118 GGDALDVLSRLLDGSFDLVF-----IDADK------------------------ADYPEYLERALPLLRPGGLIVA  164 (219)
T ss_pred             CCCHHHHHHHCCCCCCCEEE-----EECCH------------------------HHCHHHHHHHHHHHCCCCEEEE
T ss_conf             57479999733478856899-----83784------------------------3599999999997378968998