HHsearch alignment for GI: 254780875 and conserved domain: KOG0820

>KOG0820 consensus.
Probab=98.16  E-value=4.3e-07  Score=67.10  Aligned_cols=89  Identities=25%  Similarity=0.346  Sum_probs=70.9

Q ss_pred             HHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             55310123321101246860566421421123312222333210013332220024442011000122222222222222
Q gi|254780875|r   81 LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS  160 (264)
Q Consensus        81 lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~  160 (264)
T Consensus        46 v~~~I~~k----a~~k~tD~VLEvGPGTGnLT~~lLe~--~kkVvA~E~Dprmvael~krv~gtp~~~kLqV~~gD~lK~  119 (315)
T KOG0820          46 VIDQIVEK----ADLKPTDVVLEVGPGTGNLTVKLLEA--GKKVVAVEIDPRMVAELEKRVQGTPKSGKLQVLHGDFLKT  119 (315)
T ss_pred             HHHHHHHC----CCCCCCCEEEEECCCCCHHHHHHHHH--CCEEEEEECCCHHHHHHHHHHCCCCCCCEEEEEECCCCCC
T ss_conf             89999860----47899877999579877899999972--0848999408078999999866998656046885031257


Q ss_pred             CCCHHHHHHHCCHHH
Q ss_conf             210023332011333
Q gi|254780875|r  161 VEGLFDVIVSNPPYI  175 (264)
Q Consensus       161 ~~~~fD~IvsNPPYI  175 (264)
T Consensus       120 d~P~fd~cVsNlPyq  134 (315)
T KOG0820         120 DLPRFDGCVSNLPYQ  134 (315)
T ss_pred             CCCCCCEEECCCCCC
T ss_conf             885103112269853