HHsearch alignment for GI: 254780875 and conserved domain: KOG1122

>KOG1122 consensus.
Probab=96.61  E-value=0.0031  Score=41.71  Aligned_cols=153  Identities=18%  Similarity=0.170  Sum_probs=98.9

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC----CCCHHHH
Q ss_conf             01246860566421421123312222333-210013332220024442011000122222222222222----2100233
Q gi|254780875|r   93 IEKRDVVRILDLGTGTGAVCLALLKESPF-FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS----VEGLFDV  167 (264)
Q Consensus        93 ~~~~~~~~vLDlG~GsG~i~i~la~~~~~-~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~----~~~~fD~  167 (264)
T Consensus       237 L~Pq~gERIlDmcAAPGGKTt~IAalMkn~G~I~AnD~n~~r~~~l~~n~~rlGv~nti-v~n~D~~ef~~~~~~~~fDR  315 (460)
T KOG1122         237 LDPQPGERILDMCAAPGGKTTHIAALMKNTGVIFANDSNENRLKSLKANLHRLGVTNTI-VSNYDGREFPEKEFPGSFDR  315 (460)
T ss_pred             CCCCCCCEECCHHCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCCCCEE-EECCCCCCCCCCCCCCCCCE
T ss_conf             07998871121210799507789998727746996135437799999889974877448-97367632553336764231


Q ss_pred             HHHCCHHHHHHCCC--------CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE---EECCCHHHHHH
Q ss_conf             32011333210012--------21111123575433210112321025689999985378878999---81766799999
Q gi|254780875|r  168 IVSNPPYIESVIVD--------CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV---EIGYNQKVDVV  236 (264)
Q Consensus       168 IvsNPPYI~~~~~~--------~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l---Eig~~q~~~v~  236 (264)
T Consensus       316 VLLDAPCSGtgvi~K~~~vkt~k~~~di~~~~------------~LQr~LllsAi~lv~~GGvLVYSTCSI~~~ENE~vV  383 (460)
T KOG1122         316 VLLDAPCSGTGVISKDQSVKTNKTVKDILRYA------------HLQRELLLSAIDLVKAGGVLVYSTCSITVEENEAVV  383 (460)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH------------HHHHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHH
T ss_conf             45348777775554551013301299998727------------999999999873115770899985322601228999


Q ss_pred             HHH-HHC-CCCEEEEEECCCCCCE
Q ss_conf             999-978-9805899805689975
Q gi|254780875|r  237 RIF-ESR-KLFLVNAFKDYGGNDR  258 (264)
Q Consensus       237 ~ll-~~~-gf~~v~~~kD~~g~~R  258 (264)
T Consensus       384 ~yaL~K~p~~kL~p~~~~iG~~G~  407 (460)
T KOG1122         384 DYALKKRPEVKLVPTGLDIGGEGR  407 (460)
T ss_pred             HHHHHHCCCEEECCCCCCCCCCCC
T ss_conf             999970986275256566788876