HHsearch alignment for GI: 254780875 and conserved domain: KOG1269

>KOG1269 consensus.
Probab=96.30  E-value=0.0031  Score=41.78  Aligned_cols=136  Identities=21%  Similarity=0.139  Sum_probs=83.8

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC--CCCHHHHHHHCC
Q ss_conf             246860566421421123312222333210013332220024442011000122222222222222--210023332011
Q gi|254780875|r   95 KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--VEGLFDVIVSNP  172 (264)
Q Consensus        95 ~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~--~~~~fD~IvsNP  172 (264)
T Consensus       108 ~~~~~~~~~~~~g~~~~~~~i~-~f~~~~~~Gl~~n~~e~~~~~~~~~~~~l~~k~~~~~~~~~~~~fedn~fd~v~~l-  185 (364)
T KOG1269         108 CFPGSKVLDVGTGVGGPSRYIA-VFKKAGVVGLDNNAYEAFRANELAKKAYLDNKCNFVVADFGKMPFEDNTFDGVRFL-  185 (364)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHH-HHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCEEHHHHHCCCCCCCCCCCEEEE-
T ss_conf             7654111224767675167788-86257751787679999998877788876420235225551488774666748987-


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE---------------------EECC--
Q ss_conf             33321001221111123575433210112321025689999985378878999---------------------8176--
Q gi|254780875|r  173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV---------------------EIGY--  229 (264)
Q Consensus       173 PYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l---------------------Eig~--  229 (264)
T Consensus       186 -------------d~~~~~~~--------~~----~~y~Ei~rv~kpGG~~i~~e~i~~~~~~~~~~~~~~i~~~i~~gd  240 (364)
T KOG1269         186 -------------EVVCHAPD--------LE----KVYAEIYRVLKPGGLFIVKEWIKTAKLKKPNSEHVDILLEIEGGD  240 (364)
T ss_pred             -------------EECCCCCC--------HH----HHHHHHHCCCCCCCEEEEHHHHHHHHCCCCCCCCCCCCCCEECCC
T ss_conf             -------------61244786--------99----999988503677716884888876521479720110467363023


Q ss_pred             -----CHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             -----6799999999978980589980568997
Q gi|254780875|r  230 -----NQKVDVVRIFESRKLFLVNAFKDYGGND  257 (264)
Q Consensus       230 -----~q~~~v~~ll~~~gf~~v~~~kD~~g~~  257 (264)
T Consensus       241 ~~~~~~~~~d~~~~~~~~~~~~~~~~~dl~~~~  273 (364)
T KOG1269         241 ALPAETFNTDVFDLLKSFGFEHLKLEKDLALKS  273 (364)
T ss_pred             CCCCEECCCCHHHHHHHCCCHHHHHCCCCCCCC
T ss_conf             212301141399887650303422234335788