HHsearch alignment for GI: 254780875 and conserved domain: KOG1270

>KOG1270 consensus.
Probab=99.22  E-value=4.9e-12  Score=99.64  Aligned_cols=99  Identities=25%  Similarity=0.349  Sum_probs=75.3

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCC-----CCCCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             860566421421123312222333210013332220024442011000122-----222222222222210023332011
Q gi|254780875|r   98 VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-----RFDTLQSDWFSSVEGLFDVIVSNP  172 (264)
Q Consensus        98 ~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~-----~i~~~~~d~~~~~~~~fD~IvsNP  172 (264)
T Consensus        90 g~~ilDvGCGgGLLSepLArl--ga~V~GID~s~~~V~vA~~h~~~dP~~~~~~~y~l~~~~~~~-E~~~~~fDaVvcs-  165 (282)
T KOG1270          90 GMKILDVGCGGGLLSEPLARL--GAQVTGIDASDDMVEVANEHKKMDPVLEGAIAYRLEYEDTDV-EGLTGKFDAVVCS-  165 (282)
T ss_pred             CCEEEEECCCCCCCCHHHHHH--CCEEEEECCHHHHHHHHHHHHHCCCHHCCCCCEEEEHHHCCH-HHCCCCCCEEEEH-
T ss_conf             864787236755023235750--885685265599999998751049033056414630201533-2145656454419-


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             33321001221111123575433210112321025689999985378878999
Q gi|254780875|r  173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV  225 (264)
Q Consensus       173 PYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l  225 (264)
T Consensus       166 -------------evleHV------------~dp~~~l~~l~~~lkP~G~lfi  193 (282)
T KOG1270         166 -------------EVLEHV------------KDPQEFLNCLSALLKPNGRLFI  193 (282)
T ss_pred             -------------HHHHHH------------HCHHHHHHHHHHHHCCCCCEEE
T ss_conf             -------------899987------------4789999999998488982586