HHsearch alignment for GI: 254780875 and conserved domain: KOG1500

>KOG1500 consensus.
Probab=98.36  E-value=1.9e-07  Score=69.52  Aligned_cols=109  Identities=20%  Similarity=0.234  Sum_probs=77.0

Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCC-CCCCHHHHHHHCC
Q ss_conf             124686056642142112331222233321001333222002444201100012222222222222-2210023332011
Q gi|254780875|r   94 EKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS-SVEGLFDVIVSNP  172 (264)
Q Consensus        94 ~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~-~~~~~fD~IvsNP  172 (264)
T Consensus       174 sDF~~kiVlDVGaGSGILS~FAaqA-GA~~vYAvEAS~-MAqyA~~Lv~~N~~~~rItVI~GKiEdieLPEk~DviISEP  251 (517)
T KOG1500         174 SDFQDKIVLDVGAGSGILSFFAAQA-GAKKVYAVEASE-MAQYARKLVASNNLADRITVIPGKIEDIELPEKVDVIISEP  251 (517)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHH-CCCEEEEEEHHH-HHHHHHHHHHCCCCCCEEEECCCCCCEECCCCCCCEEEECC
T ss_conf             3457748998158824899999873-865389874567-99999998743663203787056320103751034787256


Q ss_pred             H-HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             3-33210012211111235754332101123210256899999853788789998176
Q gi|254780875|r  173 P-YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY  229 (264)
Q Consensus       173 P-YI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig~  229 (264)
T Consensus       252 MG~mL~NE--------RM-------------LEs----Yl~Ark~l~P~GkMfPT~gd  284 (517)
T KOG1500         252 MGYMLVNE--------RM-------------LES----YLHARKWLKPNGKMFPTVGD  284 (517)
T ss_pred             CHHHHHHH--------HH-------------HHH----HHHHHHHCCCCCCCCCCCCC
T ss_conf             21411108--------88-------------999----99998742877744675253