HHsearch alignment for GI: 254780875 and conserved domain: KOG1540

>KOG1540 consensus.
Probab=98.96  E-value=7.4e-10  Score=85.32  Aligned_cols=110  Identities=20%  Similarity=0.305  Sum_probs=83.2

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCC------CCCCCCCCCCCCHHHHHHCCCCCCCCCC--CCCCCCCCCC--CCC
Q ss_conf             01246860566421421123312222333------2100133322200244420110001222--2222222222--221
Q gi|254780875|r   93 IEKRDVVRILDLGTGTGAVCLALLKESPF------FKGVGVDISCKALEIAKSNAVTNGVSER--FDTLQSDWFS--SVE  162 (264)
Q Consensus        93 ~~~~~~~~vLDlG~GsG~i~i~la~~~~~------~~v~~~Dis~~al~~A~~N~~~~~~~~~--i~~~~~d~~~--~~~  162 (264)
T Consensus        96 L~p~~~m~~lDvaGGTGDiaFril~~v~s~~~~~~~~V~v~Dinp~mL~vgkqRa~~~~l~~~~~~~w~~~dAE~LpFdd  175 (296)
T KOG1540          96 LGPGKGMKVLDVAGGTGDIAFRILRHVKSQFGDRESKVTVLDINPHMLAVGKQRAKKRPLKASSRVEWVEGDAEDLPFDD  175 (296)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCC
T ss_conf             58777875898347752567779876113457777617999389899999987775159776871699947701089997


Q ss_pred             CHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEE-EEEC
Q ss_conf             00233320113332100122111112357543321011232102568999998537887899-9817
Q gi|254780875|r  163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS-VEIG  228 (264)
Q Consensus       163 ~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~-lEig  228 (264)
T Consensus       176 ~s~D~yT-------------iafGIRN~-------------th~~k~l~EAYRVLKpGGrf~cLeFs  216 (296)
T KOG1540         176 DSFDAYT-------------IAFGIRNV-------------THIQKALREAYRVLKPGGRFSCLEFS  216 (296)
T ss_pred             CCCEEEE-------------EECCEECC-------------CCHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             7511588-------------84211147-------------87789999998752778679999735