HHsearch alignment for GI: 254780875 and conserved domain: KOG2798

>KOG2798 consensus.
Probab=94.34  E-value=0.095  Score=31.94  Aligned_cols=56  Identities=21%  Similarity=0.214  Sum_probs=39.1

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             5553101233211012468605664214211233122223332100133322200244
Q gi|254780875|r   80 LLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIA  137 (264)
Q Consensus        80 ~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A  137 (264)
T Consensus       133 pii~~l~~lfp~~~~~r~ki~iLvPGaGlGRLa~dla~~G~~~qGN--EfSy~Mli~S  188 (369)
T KOG2798         133 PIIEELNSLFPSRGKERTKIRILVPGAGLGRLAYDLACLGFKCQGN--EFSYFMLICS  188 (369)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCC--HHHHHHHHHH
T ss_conf             4799987418986665558628814887116789988743333430--7899999999