HHsearch alignment for GI: 254780875 and conserved domain: PRK04457

>PRK04457 spermidine synthase; Provisional.
Probab=98.58  E-value=3e-07  Score=68.17  Aligned_cols=146  Identities=14%  Similarity=0.154  Sum_probs=96.0

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC---CCHHHHHHHCC
Q ss_conf             468605664214211233122223332100133322200244420110001222222222222222---10023332011
Q gi|254780875|r   96 RDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNP  172 (264)
Q Consensus        96 ~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~---~~~fD~IvsNP  172 (264)
T Consensus        65 p~Pk~vl~iGLGgGsl~k~~~~~~P~~~i~~VEIdp~Vi~vAr~~F~lP~dd~Rl~V~~~Dg~~fv~~~~~~~DvI~vD-  143 (262)
T PRK04457         65 PRPQHILQIGLGGGSFAKFIDTYLPDTRQTAVEINPQVIAVARNHFELPFEDEKFEIIEADGAEYIKVFPASTDVILVD-  143 (262)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCEEEEECCHHHHHHHCCCCCCEEEEE-
T ss_conf             9978699992570199999998398675899987889999999865799999726999553899985486777889996-


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEC---CCHHHHHHHHHHHCCCCEEEE
Q ss_conf             33321001221111123575433210112321025689999985378878999817---667999999999789805899
Q gi|254780875|r  173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG---YNQKVDVVRIFESRKLFLVNA  249 (264)
Q Consensus       173 PYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig---~~q~~~v~~ll~~~gf~~v~~  249 (264)
T Consensus       144 ----~fd~~g~~~~---------L--------~t~~Fy~~c~~~L~~~Gvlv~Nl~~~~~~~~~~l~~i~~~F~~~~~~~  202 (262)
T PRK04457        144 ----GFDGEQIVDA---------L--------VTQPFFRDCRNALSSDGVFVTNLWSGDKRYQRYIERLLSVFEGRVLEL  202 (262)
T ss_pred             ----CCCCCCCCCC---------C--------CCHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCEEEEE
T ss_conf             ----8898888600---------0--------829999999986498939999868899865999999999728739997


Q ss_pred             EECCCCCCEEEEEEC
Q ss_conf             805689975999979
Q gi|254780875|r  250 FKDYGGNDRVLLFCR  264 (264)
Q Consensus       250 ~kD~~g~~R~vi~~r  264 (264)
T Consensus       203 ~~~~~G-N~Iv~A~k  216 (262)
T PRK04457        203 PAESHG-NVAVFAFQ  216 (262)
T ss_pred             ECCCCC-EEEEEEEC
T ss_conf             258998-08999978