HHsearch alignment for GI: 254780875 and conserved domain: PRK05134

>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional.
Probab=99.57  E-value=3e-15  Score=120.81  Aligned_cols=125  Identities=19%  Similarity=0.259  Sum_probs=97.0

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC---CCCHHHHHHHC
Q ss_conf             246860566421421123312222333210013332220024442011000122222222222222---21002333201
Q gi|254780875|r   95 KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS---VEGLFDVIVSN  171 (264)
Q Consensus        95 ~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~---~~~~fD~IvsN  171 (264)
T Consensus        46 ~l~G~~ILDVGCGgG~lse~LAr~--Ga~VtGID~S~~~I~~Ar~ha~~~~l~--i~y~~~~~e~l~~~~~~~FDvV~~-  120 (233)
T PRK05134         46 GLFGKRVLDVGCGGGILSESMARL--GATVTGIDASEENIEVARLHALESGLK--IDYRQITAEELAAEHPGQFDVVTC-  120 (233)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHC--CCEEEEECCCHHHHHHHHHHHHHCCCC--CEEEECCHHHHHHHCCCCEEEEEE-
T ss_conf             668998999755897112899967--997999879989999999985644345--116751476654305786347744-


Q ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEE-------------------------
Q ss_conf             1333210012211111235754332101123210256899999853788789998-------------------------
Q gi|254780875|r  172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE-------------------------  226 (264)
Q Consensus       172 PPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lE-------------------------  226 (264)
T Consensus       121 -------------~EVlEHV------------~d~~~~l~~~~rlLKPGG~l~lsTiNrt~~S~l~~i~~AEyil~~vP~  175 (233)
T PRK05134        121 -------------MEMLEHV------------PDPASFIRACAKLVKPGGLVFFSTLNRNLKSYLLAIVGAEYILRMLPK  175 (233)
T ss_pred             -------------EHHHHHC------------CCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             -------------2147753------------899999999999738991499972678989999999999888604999


Q ss_pred             --ECCC---HHHHHHHHHHHCCCCEEEE
Q ss_conf             --1766---7999999999789805899
Q gi|254780875|r  227 --IGYN---QKVDVVRIFESRKLFLVNA  249 (264)
Q Consensus       227 --ig~~---q~~~v~~ll~~~gf~~v~~  249 (264)
T Consensus       176 gTH~w~kFi~P~el~~~l~~~~~~~~~~  203 (233)
T PRK05134        176 GTHDYKKFIKPSELAAWLRQAGLEVQDI  203 (233)
T ss_pred             CCCCHHHCCCHHHHHHHHHHCCCEEEEE
T ss_conf             9858666799999999999879957210