HHsearch alignment for GI: 254780875 and conserved domain: PRK07402

>PRK07402 precorrin-6B methylase; Provisional.
Probab=99.44  E-value=3.8e-13  Score=106.94  Aligned_cols=132  Identities=13%  Similarity=0.117  Sum_probs=98.2

Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             10124686056642142112331222233321001333222002444201100012222222222222221002333201
Q gi|254780875|r   92 RIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSN  171 (264)
Q Consensus        92 ~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~~~~fD~IvsN  171 (264)
T Consensus        35 kL~l~~~~~vwDIGaGtGsVsiEaa~~~~~g~V~AIE~~~~a~~li~~N~~rfgv~-nv~ii~g~ape~L~---------  104 (196)
T PRK07402         35 QLRLEPDSVLWDIGAGTGTIPVEAALLCPKGRVIAIERDEEVANLIRRNCDRFGVK-NVEVIEGSAPECLA---------  104 (196)
T ss_pred             HHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC-CEEEEECCCHHHHH---------
T ss_conf             70899999999947887799999998789988999976888999999989972999-87999726366684---------


Q ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEE-CCCHHHHHHHHHHHCCCCEEEEE
Q ss_conf             13332100122111112357543321011232102568999998537887899981-76679999999997898058998
Q gi|254780875|r  172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI-GYNQKVDVVRIFESRKLFLVNAF  250 (264)
Q Consensus       172 PPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEi-g~~q~~~v~~ll~~~gf~~v~~~  250 (264)
T Consensus       105 ----------~l~-----p~pD~vFIGGg~---~l~~il~~~~~~L~pgGriVinaitLetl~~~~~~l~~~~~~~~e~~  166 (196)
T PRK07402        105 ----------QLA-----PAPDRICIEGGR---PIKEILQAVWQYLKPGGRLVATASSLEGLYAISEGLAQLQARNVEVV  166 (196)
T ss_pred             ----------HCC-----CCCCEEEECCCC---CHHHHHHHHHHHCCCCCEEEEEEEEHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             ----------089-----999999984896---88999999998679998999985709889999999997388763799


Q ss_pred             E
Q ss_conf             0
Q gi|254780875|r  251 K  251 (264)
Q Consensus       251 k  251 (264)
T Consensus       167 q  167 (196)
T PRK07402        167 Q  167 (196)
T ss_pred             E
T ss_conf             9