HHsearch alignment for GI: 254780875 and conserved domain: PRK08287

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated.
Probab=99.50  E-value=5.5e-14  Score=112.48  Aligned_cols=148  Identities=20%  Similarity=0.244  Sum_probs=106.9

Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             77504620512235655531012332110124686056642142112331222233321001333222002444201100
Q gi|254780875|r   65 LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN  144 (264)
Q Consensus        65 f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~  144 (264)
T Consensus         5 ~F~r~~~pmTK~EIRai~LskL-------~l~~~~vvwDIGaGsGsvsiEaa~~~p~~~V~AvE~~~~~~~~i~~N~~~f   77 (186)
T PRK08287          5 LFLRGKVPMTKEEVRALSLSKL-------ELHRAKHLIDVGAGTGSVSIEAALQFPSLQVTAIERNPAALRLIKENRQRF   77 (186)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHC-------CCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             6234999977899999999971-------999999999957887789999999789988999937989999999989972


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             01222222222222222100233320113332100122111112357543321011232102568999998537887899
Q gi|254780875|r  145 GVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS  224 (264)
Q Consensus       145 ~~~~~i~~~~~d~~~~~~~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~  224 (264)
T Consensus        78 g~~-nv~~i~g~Ap~~l~~---------------------------~pD~vFIGGsgg~--l~~il~~~~~~L~~gGriV  127 (186)
T PRK08287         78 GCG-NIDIIPGEAPITLTG---------------------------KADAIFMGGSGGH--LTAIIDWALGHLHPGGRLV  127 (186)
T ss_pred             CCC-CEEEEECCCCHHCCC---------------------------CCCEEEEECCCCC--HHHHHHHHHHHCCCCCEEE
T ss_conf             999-879993778110357---------------------------8984999747898--8999999997579998999


Q ss_pred             EEE-CCCHHHHHHHHHHHCCCCEEEE
Q ss_conf             981-7667999999999789805899
Q gi|254780875|r  225 VEI-GYNQKVDVVRIFESRKLFLVNA  249 (264)
Q Consensus       225 lEi-g~~q~~~v~~ll~~~gf~~v~~  249 (264)
T Consensus       128 inavtlet~~~a~~~~~~~~~~~~e~  153 (186)
T PRK08287        128 LNFILQENLHSALAHLEKIGACELDC  153 (186)
T ss_pred             EEEEEHHHHHHHHHHHHHCCCCCEEE
T ss_conf             98260877999999999769976159