HHsearch alignment for GI: 254780875 and conserved domain: PRK08317

>PRK08317 hypothetical protein; Provisional.
Probab=99.45  E-value=2e-13  Score=108.84  Aligned_cols=130  Identities=20%  Similarity=0.226  Sum_probs=97.4

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC--CCCHHHHHH
Q ss_conf             012468605664214211233122223-33210013332220024442011000122222222222222--210023332
Q gi|254780875|r   93 IEKRDVVRILDLGTGTGAVCLALLKES-PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--VEGLFDVIV  169 (264)
Q Consensus        93 ~~~~~~~~vLDlG~GsG~i~i~la~~~-~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~--~~~~fD~Iv  169 (264)
T Consensus        15 L~l~pG~~vLDiGcG~G~~~~~la~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~--~~v~~~~~d~~~lp~~d~sfD~v~   92 (241)
T PRK08317         15 LAVQPGERVLDVGCGPGNDLRELADRVGPEGRVVGIDRSEAMLALARERAAGLL--SNVEFVRGDADGLPFPDESFDAVR   92 (241)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC--CCEEEEECCHHHCCCCCCCCCEEE
T ss_conf             699997999996641749999999974999789999698899999999986228--964999554643589888704562


Q ss_pred             HCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE-EECCC------------------
Q ss_conf             01133321001221111123575433210112321025689999985378878999-81766------------------
Q gi|254780875|r  170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV-EIGYN------------------  230 (264)
Q Consensus       170 sNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l-Eig~~------------------  230 (264)
T Consensus        93 ~~------~~l--------~h~------------~d~~~~l~e~~RvLkPGG~~vi~d~Dw~~~~~~~~~~~~~~~i~~~  146 (241)
T PRK08317         93 SD------RVL--------QHL------------EDPRRALAEMARVLRPGGRAVVLDTDWDTLVIHSGDRALMRKILNF  146 (241)
T ss_pred             HH------HHH--------HHC------------CCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             21------157--------622------------5899999999998188838999966788674289888999999999


Q ss_pred             ---------HHHHHHHHHHHCCCCEEEEE
Q ss_conf             ---------79999999997898058998
Q gi|254780875|r  231 ---------QKVDVVRIFESRKLFLVNAF  250 (264)
Q Consensus       231 ---------q~~~v~~ll~~~gf~~v~~~  250 (264)
T Consensus       147 ~~~~~~~~~~gr~L~~~l~~aG~~~v~~~  175 (241)
T PRK08317        147 WSDHFANPWLGRRLPGLFREAGLTDIEVE  175 (241)
T ss_pred             HHHHCCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99747892078999999998699056888