HHsearch alignment for GI: 254780875 and conserved domain: PRK09328

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.
Probab=100.00  E-value=0  Score=558.72  Aligned_cols=255  Identities=35%  Similarity=0.488  Sum_probs=243.6

Q ss_pred             CHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHCCCEEEEEEEEEEECCCCCHHHHHHHH
Q ss_conf             75689999999983899989850448858989999999999989749837685363144237677504620512235655
Q gi|254780875|r    2 QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL   81 (264)
Q Consensus         2 ~a~~dA~~Ll~~~l~~~~~~l~~~~~~~l~~~~~~~l~~~i~rr~~g~Pl~YIlg~~~F~~~~f~v~~~vLIPRpeTE~l   81 (264)
T Consensus        19 sp~ldaelLl~~~l~~~r~~l~~~~~~~l~~~~~~~~~~li~RR~~gePlqYI~G~~~F~g~~f~V~~~VLIPRPETE~L   98 (277)
T PRK09328         19 SPRRDAEILLEHVTGKGRTYILAFGETQLTDEQQQQLEALLTRRRQGEPIAYLTGEREFWSLPLFVSPATLIPRPDTECL   98 (277)
T ss_pred             CHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHCEEEEEEEEEEECCCEEEECCCHHHH
T ss_conf             98999999999997919999974878899999999999999999869978998382156525898779836408817999


Q ss_pred             HHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             53101233211012468605664214211233122223332100133322200244420110001222222222222222
Q gi|254780875|r   82 VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV  161 (264)
Q Consensus        82 v~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~  161 (264)
T Consensus        99 Ve~~l~~~~-----~~~~~ilDlgtGSGcI~isLa~~~p~~~v~a~DiS~~Al~~A~~Na~~~~l~-~v~~~~~d~~~~~  172 (277)
T PRK09328         99 VEQALARLP-----EQPCRILDLGTGTGAIALALASERPDCEVTAVDRMPDAVALAQRNAQHLAIK-NVRILQSDWFSAL  172 (277)
T ss_pred             HHHHHHHCC-----CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCC-EEEEEECCCHHHC
T ss_conf             999999645-----3788189954556999999998677989999648999999999999980988-6999944752113


Q ss_pred             CC-HHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHH
Q ss_conf             10-02333201133321001221111123575433210112321025689999985378878999817667999999999
Q gi|254780875|r  162 EG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE  240 (264)
Q Consensus       162 ~~-~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig~~q~~~v~~ll~  240 (264)
T Consensus       173 ~~~~fDlIVSNPPYI~~~~~~~~~~~v~-~EP~~AL~gg~dGl~~~~~ii~~a~~~L~~~G~l~~Eig~~Q~~~v~~l~~  251 (277)
T PRK09328        173 SGQQFAMIVSNPPYIDAQDPHLQQGDVR-FEPLSALVAADNGMADLAHIIEQARQYLVPGGWLLLEHGWQQGEAVRQLFI  251 (277)
T ss_pred             CCCCCCEEEECCCCCCCCHHHHCCHHCC-CCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHH
T ss_conf             7877788997899877000343824216-683899817975899999999999984466989999968158999999999


Q ss_pred             HCCCCEEEEEECCCCCCEEEEEE
Q ss_conf             78980589980568997599997
Q gi|254780875|r  241 SRKLFLVNAFKDYGGNDRVLLFC  263 (264)
Q Consensus       241 ~~gf~~v~~~kD~~g~~R~vi~~  263 (264)
T Consensus       252 ~~gf~~i~~~kDl~g~~R~v~ar  274 (277)
T PRK09328        252 RAGYSDVETCRDYGDNERVTLGR  274 (277)
T ss_pred             HCCCCEEEEECCCCCCCEEEEEE
T ss_conf             67997047861789992399999