HHsearch alignment for GI: 254780875 and conserved domain: PRK11207

>PRK11207 tellurite resistance protein TehB; Provisional.
Probab=99.12  E-value=3.5e-11  Score=94.04  Aligned_cols=128  Identities=18%  Similarity=0.216  Sum_probs=92.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCC
Q ss_conf             37677504620512235655531012332110124686056642142112331222233321001333222002444201
Q gi|254780875|r   62 NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNA  141 (264)
Q Consensus        62 ~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~  141 (264)
T Consensus         5 ~e~y~~~~Y~~-~~~hs~~~-~~~-~-------~~~~g~~LDlgcG~Grna~~La~~--G~~VtavD~s~~al~~~~~~a   72 (198)
T PRK11207          5 DENYFTDKYGL-TRTHSEVL-EAV-K-------VVKPGRTLDLGCGNGRNSLYLAAN--GYDVTAWDKNPMSIANLERIK   72 (198)
T ss_pred             HHHHHHCCCCC-CCCCHHHH-HHH-C-------CCCCCCEEEECCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHH
T ss_conf             34444414888-99978999-873-3-------589974777247887869999868--985999979999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             1000122222222222222-210023332011333210012211111235754332101123210256899999853788
Q gi|254780875|r  142 VTNGVSERFDTLQSDWFSS-VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD  220 (264)
Q Consensus       142 ~~~~~~~~i~~~~~d~~~~-~~~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~  220 (264)
T Consensus        73 ~~~~l~-~v~~~~~Dl~~~~~~~~yDlIlst------vv~~fl~p~------------------~~p~iia~mq~~t~PG  127 (198)
T PRK11207         73 AAENLD-NLHTRVVDLNNLTFDGEYDFILST------VVLMFLEAK------------------TIPGLIANMQRCTKPG  127 (198)
T ss_pred             HHCCCC-EEEEEEECCCCCCCCCCCCEEEEE------EEEEECCHH------------------HHHHHHHHHHHHCCCC
T ss_conf             875998-246562031238877770589786------452104866------------------7899999999960899


Q ss_pred             CEEEEE
Q ss_conf             789998
Q gi|254780875|r  221 GLCSVE  226 (264)
Q Consensus       221 G~l~lE  226 (264)
T Consensus       128 G~~LIV  133 (198)
T PRK11207        128 GYNLIV  133 (198)
T ss_pred             CEEEEE
T ss_conf             489999