HHsearch alignment for GI: 254780875 and conserved domain: PRK13944

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional.
Probab=98.85  E-value=1.6e-09  Score=83.19  Aligned_cols=134  Identities=19%  Similarity=0.232  Sum_probs=96.8

Q ss_pred             EEEEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHH
Q ss_conf             4423767750462051223565553101233211012468605664214211233122223-332100133322200244
Q gi|254780875|r   59 DFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKES-PFFKGVGVDISCKALEIA  137 (264)
Q Consensus        59 ~F~~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~-~~~~v~~~Dis~~al~~A  137 (264)
T Consensus        41 AY~D~~lpi~~~~tis~P~~~a~ml~~L-------~~~~~~~VLeIGtGsGY~tAlla~l~~~~g~V~siE~~~~L~~~A  113 (205)
T PRK13944         41 AYEDRPLPLFAGATISAPHMVAMMCELI-------EPRPGMKILEVGTGSGYQAAVCAEAIERRGKVYTVEIVKELAIYA  113 (205)
T ss_pred             CCCCCCEECCCCCEECHHHHHHHHHHHH-------CCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             7369975148998997799999999970-------689999899978985199999999837477179995369999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCC--CHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             4201100012222222222222221--00233320113332100122111112357543321011232102568999998
Q gi|254780875|r  138 KSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR  215 (264)
Q Consensus       138 ~~N~~~~~~~~~i~~~~~d~~~~~~--~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~  215 (264)
T Consensus       114 ~~~l~~l~~~n~v~v~~gdg~~G~~~~apfD~Iiv~------aa~~~i--------P--------------~~l~----~  161 (205)
T PRK13944        114 AQNIERLGYWGVVEVYHGDGKRGLEKHAPFDAIIVT------AAASTI--------P--------------SALV----R  161 (205)
T ss_pred             HHHHHHCCCCCCCEEEECCCCCCCCCCCCCCEEEEE------EECCCC--------C--------------HHHH----H
T ss_conf             999998598633067976556577434980489998------507768--------9--------------9999----8


Q ss_pred             HCCCCCEEEEEECCCH
Q ss_conf             5378878999817667
Q gi|254780875|r  216 HLNKDGLCSVEIGYNQ  231 (264)
Q Consensus       216 ~L~~~G~l~lEig~~q  231 (264)
T Consensus       162 QL~~gGrLV~Pvg~~~  177 (205)
T PRK13944        162 QLKDGGVLVIPVEEGV  177 (205)
T ss_pred             HCCCCCEEEEEECCCC
T ss_conf             5487979999987899