HHsearch alignment for GI: 254780875 and conserved domain: PTZ00098

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional.
Probab=99.38  E-value=6.3e-13  Score=105.53  Aligned_cols=132  Identities=22%  Similarity=0.277  Sum_probs=93.6

Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCC--CCCCHHHHHHHC
Q ss_conf             124686056642142112331222233321001333222002444201100012222222222222--221002333201
Q gi|254780875|r   94 EKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS--SVEGLFDVIVSN  171 (264)
Q Consensus        94 ~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~--~~~~~fD~IvsN  171 (264)
T Consensus        49 ~L~~~~kVLDvGCG~GG~a~~LA~~y-g~~V~GiDls~~~~~~A~er~~~---~~~v~f~~~d~~~~~f~d~sFDvV~S~  124 (263)
T PTZ00098         49 ELDANSKVLDIGSGLGGGCKYINEKY-GAHTHGIDICEKIVNIAKERNQD---KAKIEFEAKDILKKDFPENNFDLIYSR  124 (263)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHCCC---CCCEEEEECCCCCCCCCCCCEEEEEEE
T ss_conf             88999868886888788999999974-98799985889999999985512---585489967853677886745589875


Q ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEE---C--C---CH------------
Q ss_conf             13332100122111112357543321011232102568999998537887899981---7--6---67------------
Q gi|254780875|r  172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI---G--Y---NQ------------  231 (264)
Q Consensus       172 PPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEi---g--~---~q------------  231 (264)
T Consensus       125 ------dailHip~------------------~DK~~l~~e~~RvLKPGG~llitDw~~~~~~~~s~~~~~yi~~r~~~l  180 (263)
T PTZ00098        125 ------DAILHLSL------------------ADKKKLFEKCYKWLKPNGILLITDYCADEIENWDDEFKAYIKKRKYTL  180 (263)
T ss_pred             ------HHHHCCCH------------------HHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCC
T ss_conf             ------02230882------------------439999999999846887899975013578997398999998468766


Q ss_pred             --HHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             --99999999978980589980568
Q gi|254780875|r  232 --KVDVVRIFESRKLFLVNAFKDYG  254 (264)
Q Consensus       232 --~~~v~~ll~~~gf~~v~~~kD~~  254 (264)
T Consensus       181 ~s~~~Y~~~l~~aGF~~v~~~-Drt  204 (263)
T PTZ00098        181 IPIEEYADIIKACKFKNVEAK-DIS  204 (263)
T ss_pred             CCHHHHHHHHHHCCCCEEEEE-CCH
T ss_conf             799999999997799667875-142