HHsearch alignment for GI: 254780875 and conserved domain: TIGR00080

>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase () (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process.
Probab=97.90  E-value=1.1e-06  Score=64.34  Aligned_cols=130  Identities=15%  Similarity=0.161  Sum_probs=85.9

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHCCCC-----CCCCCCCCCCCCCCCCCCC--CHHH
Q ss_conf             24686056642142112331222233-32100133322200244420110-----0012222222222222221--0023
Q gi|254780875|r   95 KRDVVRILDLGTGTGAVCLALLKESP-FFKGVGVDISCKALEIAKSNAVT-----NGVSERFDTLQSDWFSSVE--GLFD  166 (264)
Q Consensus        95 ~~~~~~vLDlG~GsG~i~i~la~~~~-~~~v~~~Dis~~al~~A~~N~~~-----~~~~~~i~~~~~d~~~~~~--~~fD  166 (264)
T Consensus        80 L~~~~~vLeiG~GSGY~aavlA~~v~~~G~V~SiEri~~L~~~A~~~Lk~hhseqL~~-~NV~v~~GDG~~G~~~~APYd  158 (228)
T TIGR00080        80 LKPGAKVLEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELVEKARRRLKKHHSEQLGL-DNVIVIEGDGRQGWEEKAPYD  158 (228)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCHHHCCCCC
T ss_conf             1403556650478558999999987139718998535788999998765431444068-865899778865710248835


Q ss_pred             HHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCC-HHHHHHHHHHHCCCC
Q ss_conf             3320113332100122111112357543321011232102568999998537887899981766-799999999978980
Q gi|254780875|r  167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN-QKVDVVRIFESRKLF  245 (264)
Q Consensus       167 ~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig~~-q~~~v~~ll~~~gf~  245 (264)
T Consensus       159 ~I~~------~A----A~k~i------------------P~AL~----~QL~eGG~L~~Pv~~~d~~Q~l~~~~k~n-n-  204 (228)
T TIGR00080       159 AILV------TA----AAKEI------------------PKALI----DQLEEGGILVLPVGEVDEEQVLKRVEKRN-N-  204 (228)
T ss_pred             EEEE------EC----CCCCC------------------CHHHH----HHHHHCCEEEECCEEECCCEEEEEEEEEC-C-
T ss_conf             2775------23----78987------------------65789----99972898862000006753799998708-9-


Q ss_pred             EEEEEECCCCCCEEE
Q ss_conf             589980568997599
Q gi|254780875|r  246 LVNAFKDYGGNDRVL  260 (264)
Q Consensus       246 ~v~~~kD~~g~~R~v  260 (264)
T Consensus       205 -~~~~~k~~E~v~FV  218 (228)
T TIGR00080       205 -GEIIIKVVEKVLFV  218 (228)
T ss_pred             -CEEEEEECCCEEEE
T ss_conf             -60675311766775