HHsearch alignment for GI: 254780875 and conserved domain: TIGR00308

>TIGR00308 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA: S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs . The enzyme is found in both eukaryotes and archaea .; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing.
Probab=95.65  E-value=0.0021  Score=42.80  Aligned_cols=85  Identities=25%  Similarity=0.311  Sum_probs=65.7

Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC-------C
Q ss_conf             0124686056642142112331222233---32100133322200244420110001222222222222222-------1
Q gi|254780875|r   93 IEKRDVVRILDLGTGTGAVCLALLKESP---FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-------E  162 (264)
Q Consensus        93 ~~~~~~~~vLDlG~GsG~i~i~la~~~~---~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~-------~  162 (264)
T Consensus        90 nrnePyi~~~dALSasGiRaiRya~E~~fngv~~v~~ND~~P~Ave~I~~N~~~N~v~N-~~v~n~Da~~~L~~~nkat~  168 (462)
T TIGR00308        90 NRNEPYIEIADALSASGIRAIRYALEVEFNGVKKVFANDINPKAVESIKNNVKLNSVEN-IEVINEDAAAVLRKRNKATF  168 (462)
T ss_pred             CCCCHHHHHHHHHHCCCHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCC-CCCCCCHHHHHHHHHCHHHC
T ss_conf             56543789998751040889999874465761067753477378899884123244227-65455037999875121123


Q ss_pred             CHHHHHHHCC-----HHHHHH
Q ss_conf             0023332011-----333210
Q gi|254780875|r  163 GLFDVIVSNP-----PYIESV  178 (264)
Q Consensus       163 ~~fD~IvsNP-----PYI~~~  178 (264)
T Consensus       169 ~~F~viDiDPFGspAPFvd~A  189 (462)
T TIGR00308       169 RKFEVIDIDPFGSPAPFVDSA  189 (462)
T ss_pred             CCCCEEEECCCCCCCCHHHHH
T ss_conf             676437647877974158999