HHsearch alignment for GI: 254780875 and conserved domain: TIGR00438

>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2.1.1 from EC methylates the 23S rRNA. It specifically methylates the uridine in position 2552 of 23s rRNA in the 50S particle using S-adenosyl-L-methionine as a substrate. It was previously known as cell division protein ftsJ.; GO: 0016436 rRNA (uridine) methyltransferase activity, 0006364 rRNA processing.
Probab=97.68  E-value=7.4e-05  Score=52.40  Aligned_cols=143  Identities=16%  Similarity=0.177  Sum_probs=92.4

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC---------CCC-
Q ss_conf             24686056642142112331222233-3210013332220024442011000122222222222222---------210-
Q gi|254780875|r   95 KRDVVRILDLGTGTGAVCLALLKESP-FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS---------VEG-  163 (264)
Q Consensus        95 ~~~~~~vLDlG~GsG~i~i~la~~~~-~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~---------~~~-  163 (264)
T Consensus        30 ik~G~~VlDLGAAPGGWsQva~~~~G~kG~ViA~Dl~~---------~k~FP~~-nv~fi~GDftdee~l~ki~~~~g~d   99 (192)
T TIGR00438        30 IKPGDTVLDLGAAPGGWSQVAVEQVGGKGRVIAVDLQP---------MKGFPIE-NVDFIRGDFTDEEVLNKILERVGDD   99 (192)
T ss_pred             EECCCEEEECCCCCCCHHHHHHHHHCCCCEEEEEECCC---------CCCCCCC-CEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             10788678657898738778877606853389985455---------7885646-6147544767878999999857898


Q ss_pred             --HHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHH
Q ss_conf             --023332011333210012211111235754332101123210256899999853788789998176679999999997
Q gi|254780875|r  164 --LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES  241 (264)
Q Consensus       164 --~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig~~q~~~v~~ll~~  241 (264)
T Consensus       100 ekk~DVV~SD-----------aaP~~SG~-~~i---Dh~Rs~dLv~~aL~ia~~vL~~~GnfvvKv--FqGe~~d~y~~e  162 (192)
T TIGR00438       100 EKKVDVVMSD-----------AAPNISGI-WDI---DHLRSIDLVELALDIAKEVLKPKGNFVVKV--FQGEEIDEYLNE  162 (192)
T ss_pred             CCEEEEEEEC-----------CCCCCCCC-CCC---CHHHHHHHHHHHHHHHHHHHHCCCCEEEEE--EECCCHHHHHHH
T ss_conf             7437789852-----------68887898-754---344379999999999999861589899998--537428899997


Q ss_pred             --CCCCEEEEEECCCCCCE----EEEEEC
Q ss_conf             --89805899805689975----999979
Q gi|254780875|r  242 --RKLFLVNAFKDYGGNDR----VLLFCR  264 (264)
Q Consensus       242 --~gf~~v~~~kD~~g~~R----~vi~~r  264 (264)
T Consensus       163 ~r~~F~~~k~~kP~aSRk~SaEvYiva~~  191 (192)
T TIGR00438       163 LRKLFEKVKVTKPQASRKRSAEVYIVAKR  191 (192)
T ss_pred             HHHCCCEEEEECCHHHHHCCCEEEEEEEC
T ss_conf             65205476744783132057468997506