>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences . This is a set of proteobacterial proteins, which have homology in their central region to a large number of methyltransferases active on a variety of substrates. .

Probab=96.94 E-value=0.0023 Score=42.62 Aligned_cols=184 Identities=18% Similarity=0.165 Sum_probs=106.6 Q ss_pred HHCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEE Q ss_conf 50448858989999999999989749837685363144237677504620512235655531012332110124686056 Q gi|254780875|r 23 IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRIL 102 (264) Q Consensus 23 ~~~~~~~l~~~~~~~l~~~i~rr~~g~Pl~YIlg~~~F~~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vL 102 (264) T Consensus 63 ~~d~~~P~s~G~~~~~~~~~~~L------------~PWRKGPf~l~~i~iD~EW~S~~KWDR~l~----~~~pL~~~~i~ 126 (316) T TIGR00452 63 KADKSEPLSEGEKKRILEELKAL------------MPWRKGPFELYGIKIDSEWRSDIKWDRVLP----HLSPLKGRTIL 126 (316) T ss_pred HHCCCCCCCCHHHHHHHHHHHHH------------CCCCCCCCEEEEEEECCCCCCCCCHHHHCC----CCCCCCCCEEE T ss_conf 51134740101389999999862------------887688815764555043066653554312----46654577789 Q ss_pred EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCC--CCCCCCCCCCCC---CCCCCCCCHHHHHHHCCHHHHH Q ss_conf 64214211233122223332100133322200244420110--001222222222---2222221002333201133321 Q gi|254780875|r 103 DLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVT--NGVSERFDTLQS---DWFSSVEGLFDVIVSNPPYIES 177 (264) Q Consensus 103 DlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~--~~~~~~i~~~~~---d~~~~~~~~fD~IvsNPPYI~~ 177 (264) T Consensus 127 DVGC~~GY~~~~M~~~Gak-~~VG~D--P~~L~~~QFE~~~~ll~~~~~~~l~~LGiE~l~~~~pnAFD~vFs------- 196 (316) T TIGR00452 127 DVGCGSGYHLWRMLGEGAK-LLVGID--PTELFLCQFEAVRKLLDNDKRAILLPLGIEQLQELKPNAFDTVFS------- 196 (316) T ss_pred EECCCCHHHHHHHHHCCCC-EEEECC--HHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCCCEEEEE------- T ss_conf 8336870688977620782-787436--578999999999987242355754036702223207641203122------- Q ss_pred HCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEE---C------------C---------CHHH Q ss_conf 00122111112357543321011232102568999998537887899981---7------------6---------6799 Q gi|254780875|r 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI---G------------Y---------NQKV 233 (264) Q Consensus 178 ~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEi---g------------~---------~q~~ 233 (264) T Consensus 197 -------~GVLYHR-k-------SPLe----~L~~L~~~L~~~GELVL~TLviD~d~~~~LvP~~~YAkMkNVYFIPSv~ 257 (316) T TIGR00452 197 -------LGVLYHR-K-------SPLE----HLKQLKDQLVKKGELVLETLVIDGDLNTVLVPKDRYAKMKNVYFIPSVS 257 (316) T ss_pred -------CCHHHCC-C-------CCHH----HHHHHHHHHHHCCCEEEEEEEECCCCCEEECCCCCCCCEEEEEEHHHHH T ss_conf -------0202115-5-------7089----9999999987579358653466077675864754442200014202389 Q ss_pred HHHHHHHHCCCCEEEEEE Q ss_conf 999999978980589980 Q gi|254780875|r 234 DVVRIFESRKLFLVNAFK 251 (264) Q Consensus 234 ~v~~ll~~~gf~~v~~~k 251 (264) T Consensus 258 aL~~Wl~kvGF~~~~i~~ 275 (316) T TIGR00452 258 ALKNWLEKVGFENVRILD 275 (316) T ss_pred HHHHHHHHCCCCEEEEEE T ss_conf 998888744953147875

HHsearch alignment for GI: 254780875 and conserved domain: TIGR00452