>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e.g. KsgA). The bacterial enzyme KsgA catalyzes the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases in 16S rRNA. This enzyme and the resulting modified adenosine bases appear to be conserved in all species of eubacteria, eukaryotes, and archaea, and in eukaryotic organelles. Bacterial resistance to the aminoglycoside antibiotic kasugamycin involves inactivation of KsgA and resulting loss of the dimethylations, with modest consequences to the overall fitness of the organism. In contrast, the yeast ortholog, Dim1, is essential. In yeast, and presumably in other eukaryotes, the enzyme performs a vital role in pre-rRNA processing in addition to its methylating activity. The best conserved region in these enzymes is located in the N-terminal section and corresponds to a region that is probably involved in S-adenosyl methionine (SAM) binding. The crystal structure of KsgA from Escherichia coli has been solved to a resolution of 2.1A. It bears a strong similarity to the crystal structure of ErmC' from Bacillus stearothermophilus and a lesser similarity to the yeast mitochondrial transcription factor, sc-mtTFB .; GO: 0016433 rRNA (adenine) methyltransferase activity, 0006364 rRNA processing.

Probab=98.67 E-value=4e-09 Score=80.52 Aligned_cols=101 Identities=22% Similarity=0.314 Sum_probs=81.7 Q ss_pred EEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCHHHHHH Q ss_conf 237677504620512235655531012332110124686056642142112331222233321-0013332220024442 Q gi|254780875|r 61 YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK-GVGVDISCKALEIAKS 139 (264) Q Consensus 61 ~~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~-v~~~Dis~~al~~A~~ 139 (264) T Consensus 7 lGQnFL~D~~~----------~~~Iv~~----~~~~~~~~vlEIGPG~G~LT~~Ll~~~~--~~v~aiEiD~~l~~~L~~ 70 (277) T TIGR00755 7 LGQNFLIDESV----------IQKIVEA----ANVLENDVVLEIGPGLGALTEPLLKRAK--KLVTAIEIDPRLAEILRK 70 (277) T ss_pred CCCCEEECHHH----------HHHHHHH----HCCCCCCEEEEECCCCHHHHHHHHHHCC--CEEEEEEECHHHHHHHHH T ss_conf 27602408789----------9999997----4378997799973882078999998259--848999726789999875 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCC---HHH-----HHHHCCHH-HHHH Q ss_conf 011000122222222222222210---023-----33201133-3210 Q gi|254780875|r 140 NAVTNGVSERFDTLQSDWFSSVEG---LFD-----VIVSNPPY-IESV 178 (264) Q Consensus 140 N~~~~~~~~~i~~~~~d~~~~~~~---~fD-----~IvsNPPY-I~~~ 178 (264) T Consensus 71 ~~~~-~~~~~~~~i~~Dalk~~~~~~~~~~~~~~~~vv~NLPY~Issp 117 (277) T TIGR00755 71 LLSE-KLYENLEVIEGDALKVDLNSLEDFPKEDKLKVVSNLPYNISSP 117 (277) T ss_pred HCCC-CCCCCEEEEECCEEEECCCHHHHCCCCCCCEEEEECCCCHHHH T ss_conf 2154-3324257871444541232043316789857985077432489

HHsearch alignment for GI: 254780875 and conserved domain: TIGR00755