HHsearch alignment for GI: 254780875 and conserved domain: TIGR01444

>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342 Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterised as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548 ..
Probab=91.66  E-value=0.058  Score=33.34  Aligned_cols=58  Identities=19%  Similarity=0.289  Sum_probs=50.1

Q ss_pred             CEEEEECCCCCCCCCCCCCCCC--CCCCCCCCCCCCHHHHHHCCCCCCCCCC-CCCCCCCC
Q ss_conf             0566421421123312222333--2100133322200244420110001222-22222222
Q gi|254780875|r  100 RILDLGTGTGAVCLALLKESPF--FKGVGVDISCKALEIAKSNAVTNGVSER-FDTLQSDW  157 (264)
Q Consensus       100 ~vLDlG~GsG~i~i~la~~~~~--~~v~~~Dis~~al~~A~~N~~~~~~~~~-i~~~~~d~  157 (264)
T Consensus         1 ~~~D~GAn~G~~~~~~~~~~~~~~~~v~afEP~p~~~~~l~~n~~~n~~~~~~~~~~~~A~   61 (142)
T TIGR01444         1 VVIDVGANIGDFSLYFARKGAEGGGRVIAFEPLPDAYEILEENVKLNGLPNKEVKLLNAAV   61 (142)
T ss_pred             CEEEECCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEEEEE
T ss_conf             9787017704799999974178873189986895799999986203787873289973000