HHsearch alignment for GI: 254780875 and conserved domain: pfam01135

>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).
Probab=98.88  E-value=1e-09  Score=84.36  Aligned_cols=132  Identities=17%  Similarity=0.261  Sum_probs=94.4

Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHH
Q ss_conf             237677504620512235655531012332110124686056642142112331222233-3210013332220024442
Q gi|254780875|r   61 YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP-FFKGVGVDISCKALEIAKS  139 (264)
Q Consensus        61 ~~~~f~v~~~vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~-~~~v~~~Dis~~al~~A~~  139 (264)
T Consensus        44 ~D~~lpi~~~~tis~P~~~a~ml~~L-------~l~~g~~VLeIGtGsGY~tAlLa~l~~~~g~V~~iE~~~~l~~~A~~  116 (205)
T pfam01135        44 EDIPLSIGYGQTISAPHMHAMMLELL-------ELKPGMRVLEIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARR  116 (205)
T ss_pred             CCCCCCCCCCCEECHHHHHHHHHHHC-------CCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
T ss_conf             68871479998886389999999970-------78999989996699659999999983878769998358999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC--CHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             01100012222222222222221--0023332011333210012211111235754332101123210256899999853
Q gi|254780875|r  140 NAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHL  217 (264)
Q Consensus       140 N~~~~~~~~~i~~~~~d~~~~~~--~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L  217 (264)
T Consensus       117 ~l~~~~~~-nV~~~~gdg~~g~~~~apfD~Iiv~------aa~~~i--------P--------------~~l~----~qL  163 (205)
T pfam01135       117 NLEKLGLE-NVIVVVGDGRQGWPEFAPYDAIHVG------AAAPEI--------P--------------EALI----DQL  163 (205)
T ss_pred             HHHHHCCC-CEEEEECCCCCCCCCCCCCCEEEEE------EECCCC--------C--------------HHHH----HHC
T ss_conf             99984888-6589845645588333980589997------506768--------8--------------9999----962


Q ss_pred             CCCCEEEEEECCCHH
Q ss_conf             788789998176679
Q gi|254780875|r  218 NKDGLCSVEIGYNQK  232 (264)
Q Consensus       218 ~~~G~l~lEig~~q~  232 (264)
T Consensus       164 ~~gGrLv~pvg~~~~  178 (205)
T pfam01135       164 KEGGRLVIPVGPNGN  178 (205)
T ss_pred             CCCCEEEEEECCCCC
T ss_conf             879789999878995