HHsearch alignment for GI: 254780875 and conserved domain: pfam01209

>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family.
Probab=99.59  E-value=7.4e-15  Score=118.21  Aligned_cols=143  Identities=21%  Similarity=0.281  Sum_probs=111.0

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC--CCCHHHHHHHC
Q ss_conf             2468605664214211233122223-33210013332220024442011000122222222222222--21002333201
Q gi|254780875|r   95 KRDVVRILDLGTGTGAVCLALLKES-PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--VEGLFDVIVSN  171 (264)
Q Consensus        95 ~~~~~~vLDlG~GsG~i~i~la~~~-~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~--~~~~fD~IvsN  171 (264)
T Consensus        45 ~~~g~~vLDl~cGTG~~~~~l~~~~~~~~~v~gvD~S~~ML~~a~~k~~~~~~-~~i~~~~~da~~lpf~d~sfD~v~~~  123 (233)
T pfam01209        45 VKRGNKFLDVAGGTGDWTFGLSDSAGSSGKVVGLDINENMLKEGEKKAKEEGK-YNIEFLQGNAEELPFEDDSFDIVTIS  123 (233)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC-CCCEEEEECCCCCCCCCCCCCHHHHH
T ss_conf             99999899825405889999999849997499996999999999999985699-98369982166688666565731421


Q ss_pred             CHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEE-EEEC----------------------
Q ss_conf             13332100122111112357543321011232102568999998537887899-9817----------------------
Q gi|254780875|r  172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS-VEIG----------------------  228 (264)
Q Consensus       172 PPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~-lEig----------------------  228 (264)
T Consensus       124 --f-----------glrn~-------------~d~~~al~E~~RVLKPGG~l~ilefs~P~~~~~~~~~~~Y~~~ilP~i  177 (233)
T pfam01209       124 --F-----------GLRNF-------------PDYLKVLKEAFRVLKPGGRVVCLEFSKPENPLLSQAYELYFKYVMPFM  177 (233)
T ss_pred             --H-----------HHHCC-------------CCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             --0-----------12125-------------888999999998727897899997888877799999999995359997


Q ss_pred             --------------------CCHHHHHHHHHHHCCCCEEEEEECCCCCCEEEEEEC
Q ss_conf             --------------------667999999999789805899805689975999979
Q gi|254780875|r  229 --------------------YNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR  264 (264)
Q Consensus       229 --------------------~~q~~~v~~ll~~~gf~~v~~~kD~~g~~R~vi~~r  264 (264)
T Consensus       178 g~~~~~~~~aY~YL~~Si~~fp~~~~~~~~l~~~GF~~v~~~~l~~Gi~~i~~g~K  233 (233)
T pfam01209       178 GKMFAKSYKSYQYLQESIRDFPDQKTLASMFEKAGFKSVGYESLTGGIAAIHWGIK  233 (233)
T ss_pred             HHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEEEEEC
T ss_conf             79984998998519999998799999999999879977789987773789999979