HHsearch alignment for GI: 254780875 and conserved domain: pfam05219

>pfam05219 DREV DREV methyltransferase. This family contains DREV protein homologues from several eukaryotes. The function of this protein is unknown. However, these proteins appear to be related to other methyltransferases (Bateman A pers obs).
Probab=97.93  E-value=2.7e-05  Score=55.29  Aligned_cols=119  Identities=20%  Similarity=0.330  Sum_probs=78.6

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHH
Q ss_conf             46860566421421123312222333210013332220024442011000122222222222222210023332011333
Q gi|254780875|r   96 RDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYI  175 (264)
Q Consensus        96 ~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~~~~fD~IvsNPPYI  175 (264)
T Consensus        93 ~~~~~LLDlGAGdG~VT~~la~~F~--~V~aTE~S~~Mr~rL~~r----gf~--v-l~~~~~~-~~~~~fDvIscL----  158 (265)
T pfam05219        93 QEPVTLLDLGAGDGEITLRMAPTFE--EVYATELSWTMRDRLKKK----NYN--V-LTEIEWQ-ETDVNLDLILCL----  158 (265)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHC--EEEEEECCHHHHHHHHHC----CCE--E-EEEHHCC-CCCCCEEEEHHH----
T ss_conf             7766478835899789999997523--588872789999999975----986--8-7501203-568744554222----


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEE----------EECC----------------
Q ss_conf             21001221111123575433210112321025689999985378878999----------8176----------------
Q gi|254780875|r  176 ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV----------EIGY----------------  229 (264)
Q Consensus       176 ~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~l----------Eig~----------------  229 (264)
T Consensus       159 -----NvLD---Rc~~P--------------~~LL~~i~~~L~P~G~lilAvVlPf~pyVE~~~~~~~~p~e~l~~~g~~  216 (265)
T pfam05219       159 -----NLLD---RCFDP--------------FKLLEDIHLALAPNGRVIVALVLPYMHYVETNTGSHLPPRPLLENNGAS  216 (265)
T ss_pred             -----HHHH---CCCCH--------------HHHHHHHHHHCCCCCEEEEEEEECCCCEEECCCCCCCCCHHHCCCCCCC
T ss_conf             -----4453---13886--------------9999999972499967999998256201775898779952113789980


Q ss_pred             --CHHHHHHHHHHHCCCCEEEEE
Q ss_conf             --679999999997898058998
Q gi|254780875|r  230 --NQKVDVVRIFESRKLFLVNAF  250 (264)
Q Consensus       230 --~q~~~v~~ll~~~gf~~v~~~  250 (264)
T Consensus       217 ~E~~v~~l~~vl~p~GF~v~~~t  239 (265)
T pfam05219       217 FEEEVARFMEVFENAGFRVEAWT  239 (265)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999998760795788873