HHsearch alignment for GI: 254780875 and conserved domain: pfam07021

>pfam07021 MetW Methionine biosynthesis protein MetW. This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in gram-positive bacteria and certain fungi, the second and third steps are a direct sulfhydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells.
Probab=98.56  E-value=1.7e-08  Score=76.28  Aligned_cols=78  Identities=22%  Similarity=0.397  Sum_probs=57.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             22356555310123321101246860566421421123312222333210013332220024442011000122222222
Q gi|254780875|r   75 RPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQ  154 (264)
Q Consensus        75 RpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~  154 (264)
T Consensus         1 R~D~~iI~~~I----------~~~srVLDlGCG~G~ll~~-L~~~k~v~~~GvEid~~~v~~a~~k----g----~~Vi~   61 (193)
T pfam07021         1 RADFRYIARLI----------PPGSRVLDLGCGDGSLLYL-LQEEKQVDGRGIELDAAGVAECVAK----G----LSVIQ   61 (193)
T ss_pred             CCHHHHHHHHC----------CCCCEEEEECCCCCHHHHH-HHHCCCCCEEEECCCHHHHHHHHHC----C----CCEEC
T ss_conf             94689999865----------8969899836889899999-9876698769833899999999864----7----95450


Q ss_pred             CCCCCC----CCCHHHHHHHC
Q ss_conf             222222----21002333201
Q gi|254780875|r  155 SDWFSS----VEGLFDVIVSN  171 (264)
Q Consensus       155 ~d~~~~----~~~~fD~IvsN  171 (264)
T Consensus        62 ~D~d~~l~~f~d~sFD~VIls   82 (193)
T pfam07021        62 GDADKGLEHFPDKSFDYVILS   82 (193)
T ss_pred             CCHHHCHHHCCCCCCCEEEHH
T ss_conf             774459745776780378698