HHsearch alignment for GI: 254780875 and conserved domain: pfam07091

>pfam07091 FmrO Ribosomal RNA methyltransferase (FmrO). This family consists of several bacterial ribosomal RNA methyltransferase (aminoglycoside-resistance methyltransferase) proteins.
Probab=95.41  E-value=0.009  Score=38.67  Aligned_cols=72  Identities=18%  Similarity=0.178  Sum_probs=57.2

Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCHHHHHH
Q ss_conf             468605664214211233122223332100133322200244420110001222222222222222-10023332
Q gi|254780875|r   96 RDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIV  169 (264)
Q Consensus        96 ~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~~~~~i~~~~~d~~~~~-~~~fD~Iv  169 (264)
T Consensus       101 ~~p~sVlDlaCGlNPLa~pwm~~~~~~~Y~a~DId~~~i~fi~~~l~~l~v~~~~--~~~Dl~~~~p~~~~DvaL  173 (248)
T pfam07091       101 PPPRSVLDLACGLNPLAVPWMPLAPDATYHAYDIDRALIEFIRAFLALLGVPGEV--RVRDLLTDPPAEPADVAL  173 (248)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCE--EEEEECCCCCCCCCCCHH
T ss_conf             9986442000268830142336899867999707778999999999862987637--987610479988734004