HHsearch alignment for GI: 254780875 and conserved domain: pfam10294

>pfam10294 Methyltransf_16 Putative methyltransferase.
Probab=99.09  E-value=1.5e-10  Score=89.89  Aligned_cols=137  Identities=18%  Similarity=0.213  Sum_probs=93.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCC-CCCCCCCCC
Q ss_conf             2356555310123321101246860566421421123312222333210013332220024442011000-122222222
Q gi|254780875|r   76 PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG-VSERFDTLQ  154 (264)
Q Consensus        76 peTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~~~~~~v~~~Dis~~al~~A~~N~~~~~-~~~~i~~~~  154 (264)
T Consensus        23 ~aa~~La~yL~~~~~~~~~~~~~k~VLELGaG~GL~Gi~~a~~~~~~~V~lTD~-~~~l~~l~~Nv~~N~~~~~~v~~~~  101 (171)
T pfam10294        23 DAAVVLSKYLEMKITSGGNNLSGKNVLELGSGCGLVGIAVALLLPGASVTITDL-EEAIELMKKNIELNKALSSKVTAKV  101 (171)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCC-HHHHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             399999999985221353340687678705665758999998579858996383-7899999999997057899669998


Q ss_pred             CCCCCCC------CCHHHHHHHCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             2222222------1002333201133321001221111123575433210112321025689999985378878999817
Q gi|254780875|r  155 SDWFSSV------EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG  228 (264)
Q Consensus       155 ~d~~~~~------~~~fD~IvsNPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig  228 (264)
T Consensus       102 LdWg~~~~~~~~~~~~fD~Il~-------s-------D~i-Y~~-----------~~~~~L~~ti~~ll~~~g~~lla~~  155 (171)
T pfam10294       102 LDWGEELPDDVFDPHPVDLILA-------A-------DCV-YNE-----------DAFPLLVKTLKDLLGKETVILVAYK  155 (171)
T ss_pred             EECCCCCCHHHCCCCCCCEEEE-------E-------CEE-ECH-----------HHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             1108988433314677678997-------1-------213-357-----------7799999999999589989999978


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             667999999999
Q gi|254780875|r  229 YNQKVDVVRIFE  240 (264)
Q Consensus       229 ~~q~~~v~~ll~  240 (264)
T Consensus       156 ~R-~~~~~~F~~  166 (171)
T pfam10294       156 KR-REAEKRFFK  166 (171)
T ss_pred             CC-CHHHHHHHH
T ss_conf             20-677999999