HHsearch alignment for GI: 254780875 and conserved domain: pfam11599

>pfam11599 AviRa RRNA methyltransferase AviRa. This family of proteins represents the methyltransferase AviRa from Streptomyces viridochromogenes. This protein mediates the resistance to the antibiotic avilamycin. AviRa methylates a specific guanine base within the peptidyl-transferase loop of the 23S ribosomal RNA.
Probab=96.46  E-value=0.00048  Score=47.07  Aligned_cols=148  Identities=20%  Similarity=0.259  Sum_probs=86.5

Q ss_pred             EEEEEECC--CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHH
Q ss_conf             76775046--205122356555310123321101246860566421421123312222--33321001333222002444
Q gi|254780875|r   63 VRLTLSSD--TFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE--SPFFKGVGVDISCKALEIAK  138 (264)
Q Consensus        63 ~~f~v~~~--vLIPRpeTE~lv~~~l~~~~~~~~~~~~~~vLDlG~GsG~i~i~la~~--~~~~~v~~~Dis~~al~~A~  138 (264)
T Consensus        20 ~VL~sApG~P~FPVRLAsEif-qRal~~----~~g~~p~tlwDpCCG~gYlLTvlgLLhr~~i~~v~aSDVd~~al~LA~   94 (249)
T pfam11599        20 RVLHHAGGEPAFPVRLALEIF-ERALAR----LIGDAEISLWDCCCGGAYLLSILGLLHRNSIANLIASDIDPAPIELAA   94 (249)
T ss_pred             EEEECCCCCCCCCHHHHHHHH-HHHHHH----CCCCCCCCEEECCCCCHHHHHHHHHHCHHHHHHHHHCCCCHHHHHHHH
T ss_conf             376438999884189999999-999986----268887303305777118999999853157877774258878999998


Q ss_pred             HCCCCCC---CCCCCC--------------------------------------CCCCCCCCCC------CC-HHHHHHH
Q ss_conf             2011000---122222--------------------------------------2222222222------10-0233320
Q gi|254780875|r  139 SNAVTNG---VSERFD--------------------------------------TLQSDWFSSV------EG-LFDVIVS  170 (264)
Q Consensus       139 ~N~~~~~---~~~~i~--------------------------------------~~~~d~~~~~------~~-~fD~Ivs  170 (264)
T Consensus        95 ~NL~LLt~~GL~~R~~eL~e~~~~f~k~s~~~aa~aA~Rl~~~l~a~gg~~p~~~~~ADvfdp~~l~~~~~g~~pDiVvT  174 (249)
T pfam11599        95 DNLALLSKAGINAREDELKALSERFGKASHIDAAHAADRIEELLTAEGGALPCAIKTADLFDGNALEACDAGFAPDIIIT  174 (249)
T ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHEECCCCCCHHHHHHCCCCCCEEEE
T ss_conf             64544032016778999999999848825788998889999998603899861210002358603677743788886884


Q ss_pred             CCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHH
Q ss_conf             11333210012211111235754332101123210256899999853788789998176679
Q gi|254780875|r  171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQK  232 (264)
Q Consensus       171 NPPYI~~~~~~~l~~~v~~~EP~~AL~gg~dGl~~~~~ii~~~~~~L~~~G~l~lEig~~q~  232 (264)
T Consensus       175 DlPYGe~t~----------Weg~~----~~~---~v~g~l~~l~~vlp~~aVv~V~~~~~~k  219 (249)
T pfam11599       175 DLPYGEMTE----------WEEQV----GAG---GIAGLLNALAAACGADAIIAVCMDKKQK  219 (249)
T ss_pred             CCCCCCEEE----------ECCCC----CCC---CHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             378774002----------23778----997---6789999998657998089998168754