BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase
(methyltransferase) protein [Candidatus Liberibacter asiaticus str.
psy62]
         (264 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040552|gb|ACT57348.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 264

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/264 (100%), Positives = 264/264 (100%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF
Sbjct: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP
Sbjct: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
           FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV
Sbjct: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE
Sbjct: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240

Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264
           SRKLFLVNAFKDYGGNDRVLLFCR
Sbjct: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264


>gi|315122703|ref|YP_004063192.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496105|gb|ADR52704.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 293

 Score =  397 bits (1020), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/264 (71%), Positives = 222/264 (84%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           +Q LR+  SFLC VTGLSS QVI  PD++LDD QR  L  A++RSL +ESIHRI GWRDF
Sbjct: 30  LQGLRNPRSFLCGVTGLSSCQVIACPDTILDDEQRLLLKKAVIRSLNYESIHRICGWRDF 89

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           YNVRL LSSDTFEPRPETELLVDS L+F L +  K+   RILDLG G+GA+CLALLKE+ 
Sbjct: 90  YNVRLALSSDTFEPRPETELLVDSILSFFLSQRGKKKDARILDLGMGSGAICLALLKENS 149

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
           FF+G+GVDIS KALEIA+ NAV NG+S+RF  LQS+WFSS+EG FD+IVSNPPYIES +V
Sbjct: 150 FFEGLGVDISSKALEIARKNAVANGLSKRFSALQSNWFSSIEGFFDIIVSNPPYIESAVV 209

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           D LG EV++FDP I+LDGG DGLSHYR IADGVSRHL+K+G C +EIGYNQK+DV+RIFE
Sbjct: 210 DKLGPEVKNFDPVIALDGGPDGLSHYRVIADGVSRHLSKNGFCGLEIGYNQKIDVIRIFE 269

Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264
            +KLFLVN+FKDY  NDR+LLFCR
Sbjct: 270 DKKLFLVNSFKDYEKNDRILLFCR 293


>gi|332716893|ref|YP_004444359.1| protoporphyrinogen oxidase protein [Agrobacterium sp. H13-3]
 gi|325063578|gb|ADY67268.1| protoporphyrinogen oxidase protein [Agrobacterium sp. H13-3]
          Length = 289

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 167/261 (63%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           L D+   +  VTG S    ++ PD  +   +   +   + R    E +HRILG R+F+ +
Sbjct: 29  LLDARLLVADVTGFSLTDFVMKPDHPVTREESARIAAMVERRAGGEPVHRILGHREFHGL 88

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            L LS++T EPRP+TE+LVD+ L      +  +   RILDLGTGTGA+CLALLKE P   
Sbjct: 89  DLLLSTETLEPRPDTEVLVDTLLPALKKIVADKGSARILDLGTGTGAICLALLKECPEAT 148

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVG DIS  ALE A  NA  NG++ RF+T++SDWF  + G FD+IVSNPPYI S IV  L
Sbjct: 149 GVGSDISADALETAAKNAARNGLASRFETMRSDWFKKISGRFDIIVSNPPYIRSDIVTTL 208

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  DP  +LDGG DGL+ YR IA    R L ++G+  VEIG++Q++DV  IF S  
Sbjct: 209 DREVRHHDPMAALDGGQDGLAPYRLIAADAGRFLVENGIVGVEIGFDQRLDVSAIFASHG 268

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
             L++A KDYGGNDRVL F R
Sbjct: 269 FSLLDAVKDYGGNDRVLTFRR 289


>gi|222087302|ref|YP_002545839.1| protoporphyrinogen oxidase (methyltransferase) protein
           [Agrobacterium radiobacter K84]
 gi|221724750|gb|ACM27906.1| protoporphyrinogen oxidase (methyltransferase) protein
           [Agrobacterium radiobacter K84]
          Length = 291

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 150/217 (69%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L HE +HRILG R+FY + + LS  T EPRP+TE+LVD+ L  +         + +LD+G
Sbjct: 71  LNHEPVHRILGEREFYGLPMALSPATLEPRPDTEILVDTVLPHARRLATDHGTIHLLDMG 130

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TGTGA+CLALL E     G+G DIS +ALE A++NA  NG++ RFDT+Q  WF ++ G F
Sbjct: 131 TGTGAICLALLHECQQAMGIGSDISGEALETARANAARNGLAARFDTVQGSWFEAIHGRF 190

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
            VIVSNPPYIES ++  L  EV++FDP  +LDGG+DGL  YR IA   +R L++DG+  V
Sbjct: 191 HVIVSNPPYIESSVISTLAPEVKNFDPPAALDGGLDGLDAYRAIAKDAARFLHQDGIVGV 250

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           EIGY+Q+  V  +FE    FL+ A +DYG NDRVL+F
Sbjct: 251 EIGYDQRKTVTSVFEGAGFFLIEAARDYGHNDRVLVF 287


>gi|15890802|ref|NP_356474.1| protoporphyrinogen oxidase [Agrobacterium tumefaciens str. C58]
 gi|15159087|gb|AAK89259.1| protoporphyrinogen oxidase [Agrobacterium tumefaciens str. C58]
          Length = 289

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 166/261 (63%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           L D+   +  VTG S    ++ P+  +   +   +   I R  + E +HRILG R+F+ +
Sbjct: 29  LVDARLLIADVTGFSLTDFVMKPEHPVTQDESARIAAMIERRAEGEPVHRILGHREFHGL 88

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            L LS +T EPRP+TE+LVD+ L      + ++   RILDLGTGTGA+CLALLKE     
Sbjct: 89  DLLLSKETLEPRPDTEVLVDTLLPALKEAVSRKGSARILDLGTGTGAICLALLKECAQAS 148

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+G DIS  ALE A  NA  NG+  RF+T++S+WF  + G FD+IVSNPPYI + IV  L
Sbjct: 149 GIGSDISADALETAAKNAARNGLDSRFETIRSNWFEKISGRFDIIVSNPPYIRTDIVATL 208

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR+ DP  +LDGG DGL+ YR IA    R L ++G   VEIG++Q++DV  IF S  
Sbjct: 209 DPEVRNHDPMAALDGGQDGLAPYRLIAADAGRFLVENGTVGVEIGFDQRLDVSAIFASHG 268

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
             L++A KDYGGNDRVL F R
Sbjct: 269 FSLLDAVKDYGGNDRVLTFRR 289


>gi|209551099|ref|YP_002283016.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536855|gb|ACI56790.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 286

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 164/258 (63%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  +  LS  +++      L   Q   L+ A+ R L HE +HRILG R+FY + L
Sbjct: 27  DARLLVAGLLKLSPTELLTRSAERLSPEQAEVLSKAVERRLGHEPVHRILGEREFYGLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS++T EPRP+TE+LVD+ LA      +++  + ILD+GTGTGA+CLALL E P   GV
Sbjct: 87  ALSAETLEPRPDTEILVDTVLACLKDLAKEQSHLHILDVGTGTGAICLALLSECPDASGV 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G DIS  AL  A+SNA  NG+ +RF  +QS WF S++G F  IVSNPPYI S ++  L  
Sbjct: 147 GSDISADALRTARSNAERNGLQDRFQAVQSRWFESIQGSFHAIVSNPPYIASNVIHDLAP 206

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV  FDP  +LDGG DGL  YR IA   +R +  DG+  +EIGY+Q+ DV  IFE++   
Sbjct: 207 EVTKFDPVAALDGGPDGLDAYRAIAKDAARFMRPDGVVGLEIGYDQRNDVTAIFEAKGFK 266

Query: 246 LVNAFKDYGGNDRVLLFC 263
            + + KDYG NDRVL+F 
Sbjct: 267 CLKSVKDYGQNDRVLVFA 284


>gi|116254018|ref|YP_769856.1| protein methyltransferase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258666|emb|CAK09770.1| putative protein methyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 286

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 167/260 (64%), Gaps = 4/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  +  LS  ++++     L   Q   +  A+ R L HE +HRILG R+FY + L
Sbjct: 27  DARLLVAGLLKLSPTELLMRSAERLSPEQAKVIFKALERRLGHEPVHRILGEREFYGLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAF--SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            LS++T EPRP+TE+LVD+ L +   L +++ R  + ILD+GTGTGA+CLALL E P   
Sbjct: 87  RLSAETLEPRPDTEILVDTVLVYLKDLAKVQNR--LHILDMGTGTGAICLALLSECPDAS 144

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVG DIS  AL  A+SNA  NG+ +RF+ +QS+WF  ++G F  IVSNPPYI S ++  L
Sbjct: 145 GVGSDISADALLTARSNAERNGLQDRFEAVQSNWFEDIQGSFHAIVSNPPYIASNVIHDL 204

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV  FDP  +LDGG DGL  Y+ IA   +R +  DG+  +EIGY+Q+ DV  IFE++ 
Sbjct: 205 APEVTKFDPAAALDGGPDGLDAYKAIAKDAARFIRPDGVVGLEIGYDQRNDVTAIFEAKG 264

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              + + KDYG NDRVL+F 
Sbjct: 265 FRCLKSVKDYGQNDRVLVFA 284


>gi|260467161|ref|ZP_05813339.1| modification methylase, HemK family [Mesorhizobium opportunistum
           WSM2075]
 gi|259029085|gb|EEW30383.1| modification methylase, HemK family [Mesorhizobium opportunistum
           WSM2075]
          Length = 292

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 158/259 (61%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   +G +  Q I DP+  +  R    +  A+ R    E +HRILG+R+FY +RL
Sbjct: 31  DARLIVEHFSGTTRTQAIADPEFKVHGRAIETIDAALRRRAGGEPVHRILGYREFYGLRL 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +LS +T EPRP+TE LV++ L F      +    RILDLGTGTGA+ LALL   P     
Sbjct: 91  SLSPETLEPRPDTETLVEAILPFVKAIAAREGACRILDLGTGTGAIALALLSAEPAATAT 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDI+  AL  A  NA   G+  RF  LQSDWF  V G + VI +NPPYI S  +  L  
Sbjct: 151 GVDIAPGALATATGNAGQLGLGGRFTALQSDWFEKVSGRYHVIAANPPYIPSQDIGNLQD 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRDFDPR++LDGG+DGL+ YR IA   +R L  +G  +VEIG  Q+ +V  IF S    
Sbjct: 211 EVRDFDPRLALDGGVDGLNPYRIIAAEAARFLEAEGRVAVEIGRTQQDEVTDIFRSAGYG 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           LV AF+D GGNDRVL+F R
Sbjct: 271 LVGAFRDLGGNDRVLVFQR 289


>gi|86359339|ref|YP_471231.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli CFN 42]
 gi|86283441|gb|ABC92504.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli CFN 42]
          Length = 286

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 160/258 (62%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  +  LSS +++      L   Q   +  A+ R L HE +HRILG R+FY + L
Sbjct: 27  DARLLVAGLLKLSSTELLTRSAEKLSPEQIEVIFKAVERRLGHEPVHRILGEREFYGLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LSS T EPRP+TE+LVD+ L +     + +  + ILD+GTG+GA+CLALL E P   G+
Sbjct: 87  GLSSGTLEPRPDTEILVDTVLPYLKDLAKAQRHLHILDIGTGSGAICLALLSECPAASGI 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G DIS  AL  AKSNA  NG+ +RF  +QS WF +++G F  IVSNPPYI S ++  L  
Sbjct: 147 GSDISADALRTAKSNAERNGLQDRFQAVQSKWFENIQGSFHAIVSNPPYIASNVIHDLAP 206

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV  FDP  +LDGG DGL  Y+ IA    R +  DG+  +EIGY+Q+ DV  IFE++   
Sbjct: 207 EVTKFDPVAALDGGPDGLDAYKAIAKDAVRFMRPDGILGLEIGYDQRNDVTAIFEAKGFR 266

Query: 246 LVNAFKDYGGNDRVLLFC 263
            + + KDYG NDR L+F 
Sbjct: 267 CLKSVKDYGQNDRALVFA 284


>gi|241206501|ref|YP_002977597.1| modification methylase, HemK family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860391|gb|ACS58058.1| modification methylase, HemK family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 286

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 119/260 (45%), Positives = 165/260 (63%), Gaps = 4/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  +  LS  +++      L   Q   +  A+ R L HE +HRILG R+FY + L
Sbjct: 27  DARLLVAGLLKLSPTELLTRSAERLSAEQAEAIFRALERRLGHEPVHRILGEREFYGLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAF--SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            LS++T EPRP+TE+LVD+ L +   L +++ R  + ILD+GTGTGA+CLALL + P   
Sbjct: 87  RLSAETLEPRPDTEILVDTVLVYLKDLAKVQSR--LHILDMGTGTGAICLALLSDCPDAS 144

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVG DIS  AL  A+SNA  NG+ +RF  +QS WF +++G F  IVSNPPYI S ++  L
Sbjct: 145 GVGSDISADALLTARSNAERNGLQDRFQVVQSSWFENIQGSFHAIVSNPPYIASNVIHDL 204

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV  FDP  +LDGG DGL  Y+ IA   +R +  DG+  +EIGY+Q+ DV  IFE++ 
Sbjct: 205 APEVTKFDPAAALDGGPDGLDAYKAIAKDAARFIRPDGVVGLEIGYDQRNDVTAIFEAKG 264

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              + + KDYG NDRVL+F 
Sbjct: 265 FRCLKSVKDYGQNDRVLVFA 284


>gi|327193409|gb|EGE60309.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli CNPAF512]
          Length = 279

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 159/253 (62%), Gaps = 3/253 (1%)

Query: 14  VTGL---SSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSD 70
           V GL   SS +++      L   Q   ++ A+ R L HE +HRILG R+FY + L LS++
Sbjct: 25  VAGLLKQSSTELLTRSAEKLSPDQIAMISKALERRLGHEPVHRILGEREFYGLPLQLSAE 84

Query: 71  TFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDIS 130
           T EPRP+TE+LVD+ LA+     +    + ILD+GTGTGA+CLALL E P   G+G DIS
Sbjct: 85  TLEPRPDTEILVDTVLAYLKDLAKAHGDLHILDIGTGTGAICLALLSECPEASGIGSDIS 144

Query: 131 CKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDF 190
             AL  A+SNA  +G+ +RF  +QS WF ++ G F  IVSNPPYI S ++  L  EV  F
Sbjct: 145 ADALGTARSNAERHGLQDRFQAVQSSWFENIRGSFHAIVSNPPYIASNVIHDLAPEVTKF 204

Query: 191 DPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAF 250
           DP  +LDGG DGL  Y  IA   +R +  DG+  +EIGY+Q+ DV  IFE++    + + 
Sbjct: 205 DPVAALDGGPDGLDAYHAIAKDAARFMRPDGVLGLEIGYDQRNDVTAIFEAKGFRCLKSV 264

Query: 251 KDYGGNDRVLLFC 263
           KDYG NDR L+F 
Sbjct: 265 KDYGQNDRALMFA 277


>gi|190893590|ref|YP_001980132.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli CIAT 652]
 gi|190698869|gb|ACE92954.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli CIAT 652]
          Length = 286

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 159/253 (62%), Gaps = 3/253 (1%)

Query: 14  VTGL---SSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSD 70
           V GL   SS +++      L   Q   ++ A+ R L HE +HRILG R+FY + L LS++
Sbjct: 32  VAGLLKQSSTELLTRSAEKLSPDQIAMISKALERRLGHEPVHRILGEREFYGLPLQLSAE 91

Query: 71  TFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDIS 130
           T EPRP+TE+LVD+ LA+     +    + ILD+GTGTGA+CLALL E P   G+G DIS
Sbjct: 92  TLEPRPDTEILVDTVLAYLKDLAKAHGDLHILDIGTGTGAICLALLSECPEASGIGSDIS 151

Query: 131 CKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDF 190
             AL  A+SNA  +G+ +RF  +QS WF ++ G F  IVSNPPYI S ++  L  EV  F
Sbjct: 152 ADALGTARSNAERHGLQDRFHAVQSSWFENIRGSFHAIVSNPPYIASNVIHDLAPEVTKF 211

Query: 191 DPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAF 250
           DP  +LDGG DGL  Y  IA   +R +  DG+  +EIGY+Q+ DV  IFE++    + + 
Sbjct: 212 DPVAALDGGPDGLDAYHAIAKDAARFMRPDGVLGLEIGYDQRNDVTAIFEAKGFRCLKSV 271

Query: 251 KDYGGNDRVLLFC 263
           KDYG NDR L+F 
Sbjct: 272 KDYGQNDRALMFA 284


>gi|13472969|ref|NP_104536.1| protoporphyrinogen oxidase, hemK protein [Mesorhizobium loti
           MAFF303099]
 gi|18202648|sp|Q98G94|HEMK_RHILO RecName: Full=Protein methyltransferase hemK homolog; AltName:
           Full=M.MloHemKP
 gi|14023717|dbj|BAB50322.1| protoporphyrinogen oxidase; HemK [Mesorhizobium loti MAFF303099]
          Length = 290

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 118/257 (45%), Positives = 157/257 (61%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   +G +  Q I DP+  +D      +  A+ R    E +HRILG+R+FY +RL
Sbjct: 31  DARLIVEHFSGTTRTQAIADPERTIDSNAIAAIDAALGRRAGGEPVHRILGYREFYGLRL 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +LS +T EPRP+TE LV++ L F      +    RILDLGTGTGA+ LALL   P     
Sbjct: 91  SLSPETLEPRPDTETLVEAVLPFVKAMAAREGTCRILDLGTGTGAIALALLSAVPAATAT 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS  AL  A  NA   G+  RF T+QSDWF  V G + VI +NPPYI +  +  L  
Sbjct: 151 GVDISAGALATAARNAGELGLGGRFTTVQSDWFEKVSGRYHVIAANPPYIPTRDIGNLQD 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRDFDPR++LDGG+DGL+ YR IA   +R L  +   +VEIG+ Q+ +V  IF++    
Sbjct: 211 EVRDFDPRLALDGGVDGLNPYRIIAAEAARFLEAESRIAVEIGHTQRDEVTDIFKAAGYA 270

Query: 246 LVNAFKDYGGNDRVLLF 262
            V A +D GGNDRVL+F
Sbjct: 271 SVAALRDLGGNDRVLVF 287


>gi|222149910|ref|YP_002550867.1| protoporphyrinogen oxidase [Agrobacterium vitis S4]
 gi|221736892|gb|ACM37855.1| protoporphyrinogen oxidase [Agrobacterium vitis S4]
          Length = 293

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 167/262 (63%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+ + +  + GL+S  +IV  + VL   +   +  A+ R L  E +HRILG R FY 
Sbjct: 27  APRDARTLIAGLLGLTSTDLIVQDNRVLSAEETSLIETAVERRLLFEPVHRILGRRAFYG 86

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L LS  T EPRP+TE+L++  L      + K   VR+LD+GTGTGA+ LALL+E P  
Sbjct: 87  LELALSPATLEPRPDTEILIERVLPHLHAMVAKNGSVRLLDMGTGTGAIALALLQECPGT 146

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
             +  DIS +AL +A+ NA  N +S+RF+TLQS W+ ++ G FD+I+SNPPYI S ++  
Sbjct: 147 TALATDISAEALAMARQNAAANSLSDRFETLQSHWYEALSGRFDIILSNPPYIVSDVIKD 206

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +VR +DP ++LDGG DGL  YR IA G +  L   GL  VEIGY+Q + V ++F + 
Sbjct: 207 LAPDVRLYDPAVALDGGDDGLDAYRAIAAGAADFLKPGGLVGVEIGYDQAMAVTQLFANN 266

Query: 243 KLFLVNAFKDYGGNDRVLLFCR 264
              LV + KD+G NDR+LLF +
Sbjct: 267 SFVLVESAKDHGDNDRILLFAQ 288


>gi|319781346|ref|YP_004140822.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167234|gb|ADV10772.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 290

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 157/259 (60%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   +G +  Q I DP+  +       +  A+ R    E +HRILG+R+FY +RL
Sbjct: 29  DARLIVEHFSGTTRTQAIADPERRVGAGAVAEIDAALRRRAGGEPVHRILGYREFYGLRL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +LS +T EPRP+TE LV++ L F      +    RILDLGTGTGA+ LALL   P     
Sbjct: 89  SLSPETLEPRPDTETLVEAILPFVKAVATQEGECRILDLGTGTGAIALALLSVVPTANAT 148

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD+S  AL  A  NA   G++ RF  LQSDWF  V G + VIV+NPPYI S  +  L  
Sbjct: 149 GVDLSAGALATAARNAGQLGLAGRFTALQSDWFEKVSGRYHVIVANPPYISSEDIGNLQD 208

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV +FDPR++LDGG DGL+ YRTIA   +R L  +G  +VEIG+ Q+ +V  IF +    
Sbjct: 209 EVLNFDPRLALDGGADGLNPYRTIAAEAARFLEIEGRIAVEIGHTQRNEVCEIFTAAGYV 268

Query: 246 LVNAFKDYGGNDRVLLFCR 264
             + F+D GGNDRV++F R
Sbjct: 269 PGSVFRDLGGNDRVIVFER 287


>gi|218660371|ref|ZP_03516301.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium
           etli IE4771]
          Length = 215

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 141/213 (66%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +HRILG R+FY + L LS++T EPRP+TE+LVD+ LA+     +    + ILD+GTGTGA
Sbjct: 1   MHRILGEREFYGLPLQLSAETREPRPDTEILVDTVLAYLKDLAKVHGHLHILDIGTGTGA 60

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           +CLALL E P   G+G DIS  AL  A+SNA  NG+ +RF  +QS WF  ++G F  IVS
Sbjct: 61  ICLALLSECPEASGIGSDISADALGTARSNAERNGLQDRFQAVQSRWFEDIQGSFHAIVS 120

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S ++  L  EV  FDP  +LDGG DGL  Y  IA   +R +  DG+  +EIGY+
Sbjct: 121 NPPYIASNVIHDLAPEVTKFDPVAALDGGPDGLDAYHAIAKDAARFMRPDGVLGLEIGYD 180

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           Q+ DV  IFE++    + + KDYG NDR L+F 
Sbjct: 181 QRNDVTAIFEAKGFSCLKSVKDYGQNDRALIFA 213


>gi|15966363|ref|NP_386716.1| putative methyltransferase protein [Sinorhizobium meliloti 1021]
 gi|307313050|ref|ZP_07592677.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sinorhizobium meliloti BL225C]
 gi|307321057|ref|ZP_07600463.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sinorhizobium meliloti AK83]
 gi|15075634|emb|CAC47189.1| Putative methyltransferase [Sinorhizobium meliloti 1021]
 gi|306893332|gb|EFN24112.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sinorhizobium meliloti AK83]
 gi|306899369|gb|EFN30003.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sinorhizobium meliloti BL225C]
          Length = 293

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 149/222 (67%)

Query: 41  AIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR 100
           A+ R   HE ++RILG R+F+ ++L LS +T EPRP+TE+LVD  +  +      +   R
Sbjct: 62  AVERRAAHEPVYRILGEREFFGLKLKLSKETLEPRPDTEILVDCLIPHARRIASSKGSCR 121

Query: 101 ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS 160
           I+DLGTGTGA+CLALL      +G+G DIS  AL  A  NA  NG++ERF T++S WF +
Sbjct: 122 IVDLGTGTGAICLALLAAVLDARGLGTDISEDALATALENARRNGLAERFGTVRSKWFEA 181

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           V+G FD+IVSNPPYI S ++  L  EVR  DP  +LDGG DGL  YR IA    RHL  D
Sbjct: 182 VDGRFDIIVSNPPYIRSNVIPELEPEVRYHDPVAALDGGEDGLDAYRAIASHAGRHLETD 241

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           G+  +EIG++QK  V  +FE++   L++A KD GGNDRVL+F
Sbjct: 242 GVIGLEIGFDQKRAVTALFEAQGFRLLSAAKDLGGNDRVLVF 283


>gi|110635327|ref|YP_675535.1| HemK family modification methylase [Mesorhizobium sp. BNC1]
 gi|110286311|gb|ABG64370.1| [protein release factor]-glutamine N5-methyltransferase
           [Chelativorans sp. BNC1]
          Length = 288

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 114/243 (46%), Positives = 149/243 (61%)

Query: 21  QVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETEL 80
           Q I  P+  ++      +  A+ R +  E +HRILG RDFY ++L LS +T EPRP+TE 
Sbjct: 43  QAITHPECAVEAAVAEKVARAVERRIAGEPVHRILGHRDFYGLKLALSPETLEPRPDTET 102

Query: 81  LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN 140
           LVD  L  +      +   RILDLGTGTGA+ LALL   P  + VG DIS  ALE A+ N
Sbjct: 103 LVDLVLPEARRIANVKKHCRILDLGTGTGAIALALLSVVPEAEAVGTDISEGALETARHN 162

Query: 141 AVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGI 200
           A  + V+ERF  L+SDWF +V+G FD+IVSNPPYI +  ++ L  EVR+ DP+ +LDGG 
Sbjct: 163 ADMSFVAERFTPLRSDWFRNVDGRFDLIVSNPPYIATAEMETLPREVREHDPKAALDGGP 222

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           DGL  YR IA G   HL ++GL +VE G  QK  V  IF +    +    +D GG DR +
Sbjct: 223 DGLMPYRAIASGARDHLTREGLIAVETGAEQKAAVAAIFAAEGYAVSRTARDLGGRDRAM 282

Query: 261 LFC 263
           LF 
Sbjct: 283 LFA 285


>gi|150397699|ref|YP_001328166.1| HemK family modification methylase [Sinorhizobium medicae WSM419]
 gi|150029214|gb|ABR61331.1| modification methylase, HemK family [Sinorhizobium medicae WSM419]
          Length = 292

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 146/222 (65%)

Query: 41  AIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR 100
           A+ R   HE ++RILG R+F  ++L LS +T EPRP+TE +V+  +  +     K+   R
Sbjct: 62  AVERRAAHEPVYRILGEREFSGLKLKLSKETLEPRPDTETMVECLIPHARRIALKKGSCR 121

Query: 101 ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS 160
           I+DLGTGTGA+CLALL      +G+G DIS  AL  A  NA  NG++ RF+TL+S+W  +
Sbjct: 122 IVDLGTGTGAICLALLDAVLDARGLGTDISEDALATACENARRNGLAGRFETLRSNWLEA 181

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           V G FD+IVSNPPYI S ++  L  EV+  DP  +LDGG DGL+ YR IA    RHL  D
Sbjct: 182 VNGRFDIIVSNPPYIRSNVIPDLEPEVKFHDPAAALDGGEDGLNAYRAIASDAGRHLEPD 241

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           G+  +EIG++QK  V  +FE+    ++ A KD GGNDRVL+F
Sbjct: 242 GVIGLEIGFDQKQAVTALFEAHGFHMLYAAKDLGGNDRVLVF 283


>gi|306842977|ref|ZP_07475611.1| protein-glutamine-N5 methyltransferase, release factor-specific
           [Brucella sp. BO2]
 gi|306286905|gb|EFM58430.1| protein-glutamine-N5 methyltransferase, release factor-specific
           [Brucella sp. BO2]
          Length = 295

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 152/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +  +  +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGMAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|163843894|ref|YP_001628298.1| HemK family methyltransferase [Brucella suis ATCC 23445]
 gi|189024939|ref|YP_001935707.1| methyltransferase [Brucella abortus S19]
 gi|225628072|ref|ZP_03786107.1| methyltransferase, HemK family protein [Brucella ceti str. Cudo]
 gi|225853307|ref|YP_002733540.1| methyltransferase, HemK family protein [Brucella melitensis ATCC
           23457]
 gi|237816234|ref|ZP_04595227.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella abortus str. 2308 A]
 gi|254690016|ref|ZP_05153270.1| methyltransferase, HemK family protein [Brucella abortus bv. 6 str.
           870]
 gi|254694506|ref|ZP_05156334.1| methyltransferase, HemK family protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696131|ref|ZP_05157959.1| methyltransferase, HemK family protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700515|ref|ZP_05162343.1| methyltransferase, HemK family protein [Brucella suis bv. 5 str.
           513]
 gi|254707599|ref|ZP_05169427.1| methyltransferase, HemK family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254708864|ref|ZP_05170675.1| methyltransferase, HemK family protein [Brucella pinnipedialis
           B2/94]
 gi|254713713|ref|ZP_05175524.1| methyltransferase, HemK family protein [Brucella ceti M644/93/1]
 gi|254715937|ref|ZP_05177748.1| methyltransferase, HemK family protein [Brucella ceti M13/05/1]
 gi|254717938|ref|ZP_05179749.1| methyltransferase, HemK family protein [Brucella sp. 83/13]
 gi|254731049|ref|ZP_05189627.1| methyltransferase, HemK family protein [Brucella abortus bv. 4 str.
           292]
 gi|256030390|ref|ZP_05444004.1| methyltransferase, HemK family protein [Brucella pinnipedialis
           M292/94/1]
 gi|256045466|ref|ZP_05448353.1| methyltransferase, HemK family protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256158373|ref|ZP_05456271.1| methyltransferase, HemK family protein [Brucella ceti M490/95/1]
 gi|256253792|ref|ZP_05459328.1| methyltransferase, HemK family protein [Brucella ceti B1/94]
 gi|256258271|ref|ZP_05463807.1| methyltransferase, HemK family protein [Brucella abortus bv. 9 str.
           C68]
 gi|256263205|ref|ZP_05465737.1| methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|260169299|ref|ZP_05756110.1| methyltransferase, HemK family protein [Brucella sp. F5/99]
 gi|260545991|ref|ZP_05821731.1| methyltransferase [Brucella abortus NCTC 8038]
 gi|260755552|ref|ZP_05867900.1| modification methylase [Brucella abortus bv. 6 str. 870]
 gi|260758775|ref|ZP_05871123.1| modification methylase [Brucella abortus bv. 4 str. 292]
 gi|260760499|ref|ZP_05872842.1| modification methylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884576|ref|ZP_05896190.1| modification methylase [Brucella abortus bv. 9 str. C68]
 gi|261214823|ref|ZP_05929104.1| modification methylase [Brucella abortus bv. 3 str. Tulya]
 gi|261217700|ref|ZP_05931981.1| modification methylase [Brucella ceti M13/05/1]
 gi|261315086|ref|ZP_05954283.1| modification methylase [Brucella pinnipedialis M163/99/10]
 gi|261316357|ref|ZP_05955554.1| modification methylase [Brucella pinnipedialis B2/94]
 gi|261321453|ref|ZP_05960650.1| modification methylase [Brucella ceti M644/93/1]
 gi|261751019|ref|ZP_05994728.1| modification methylase [Brucella suis bv. 5 str. 513]
 gi|261758812|ref|ZP_06002521.1| methyltransferase [Brucella sp. F5/99]
 gi|265982881|ref|ZP_06095616.1| modification methylase [Brucella sp. 83/13]
 gi|265987429|ref|ZP_06099986.1| modification methylase [Brucella pinnipedialis M292/94/1]
 gi|265991892|ref|ZP_06104449.1| modification methylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265996885|ref|ZP_06109442.1| modification methylase [Brucella ceti M490/95/1]
 gi|294851111|ref|ZP_06791784.1| protein-(glutamine-N5) methyltransferase [Brucella sp. NVSL
           07-0026]
 gi|297247115|ref|ZP_06930833.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella abortus bv. 5 str. B3196]
 gi|306838262|ref|ZP_07471112.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella sp. NF 2653]
 gi|163674617|gb|ABY38728.1| methyltransferase, HemK family [Brucella suis ATCC 23445]
 gi|189020511|gb|ACD73233.1| Methyltransferase [Brucella abortus S19]
 gi|225616897|gb|EEH13944.1| methyltransferase, HemK family protein [Brucella ceti str. Cudo]
 gi|225641672|gb|ACO01586.1| methyltransferase, HemK family protein [Brucella melitensis ATCC
           23457]
 gi|237788301|gb|EEP62516.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella abortus str. 2308 A]
 gi|260096098|gb|EEW79974.1| methyltransferase [Brucella abortus NCTC 8038]
 gi|260669093|gb|EEX56033.1| modification methylase [Brucella abortus bv. 4 str. 292]
 gi|260670931|gb|EEX57752.1| modification methylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675660|gb|EEX62481.1| modification methylase [Brucella abortus bv. 6 str. 870]
 gi|260874104|gb|EEX81173.1| modification methylase [Brucella abortus bv. 9 str. C68]
 gi|260916430|gb|EEX83291.1| modification methylase [Brucella abortus bv. 3 str. Tulya]
 gi|260922789|gb|EEX89357.1| modification methylase [Brucella ceti M13/05/1]
 gi|261294143|gb|EEX97639.1| modification methylase [Brucella ceti M644/93/1]
 gi|261295580|gb|EEX99076.1| modification methylase [Brucella pinnipedialis B2/94]
 gi|261304112|gb|EEY07609.1| modification methylase [Brucella pinnipedialis M163/99/10]
 gi|261738796|gb|EEY26792.1| methyltransferase [Brucella sp. F5/99]
 gi|261740772|gb|EEY28698.1| modification methylase [Brucella suis bv. 5 str. 513]
 gi|262551353|gb|EEZ07343.1| modification methylase [Brucella ceti M490/95/1]
 gi|263002900|gb|EEZ15251.1| modification methylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093127|gb|EEZ17262.1| methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659626|gb|EEZ29887.1| modification methylase [Brucella pinnipedialis M292/94/1]
 gi|264661473|gb|EEZ31734.1| modification methylase [Brucella sp. 83/13]
 gi|294819700|gb|EFG36699.1| protein-(glutamine-N5) methyltransferase [Brucella sp. NVSL
           07-0026]
 gi|297174284|gb|EFH33631.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella abortus bv. 5 str. B3196]
 gi|306406665|gb|EFM62894.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella sp. NF 2653]
 gi|326409871|gb|ADZ66936.1| Methyltransferase [Brucella melitensis M28]
 gi|326539584|gb|ADZ87799.1| methyltransferase, HemK family protein [Brucella melitensis M5-90]
          Length = 295

 Score =  208 bits (529), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|256112205|ref|ZP_05453126.1| methyltransferase, HemK family protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265993633|ref|ZP_06106190.1| modification methylase [Brucella melitensis bv. 3 str. Ether]
 gi|262764614|gb|EEZ10535.1| modification methylase [Brucella melitensis bv. 3 str. Ether]
          Length = 295

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVGALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|62290729|ref|YP_222522.1| hypothetical protein BruAb1_1847 [Brucella abortus bv. 1 str.
           9-941]
 gi|261220925|ref|ZP_05935206.1| modification methylase [Brucella ceti B1/94]
 gi|62196861|gb|AAX75161.1| HemK [Brucella abortus bv. 1 str. 9-941]
 gi|260919509|gb|EEX86162.1| modification methylase [Brucella ceti B1/94]
          Length = 290

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 26  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 86  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 146 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 205

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 206 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 265

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 266 LAGEANDLGGHRRAMLFGQ 284


>gi|82700641|ref|YP_415215.1| N-6 adenine-specific DNA methylase [Brucella melitensis biovar
           Abortus 2308]
 gi|148560045|ref|YP_001259696.1| protein-(glutamine-N5) methyltransferase [Brucella ovis ATCC 25840]
 gi|256370268|ref|YP_003107779.1| hemK protein [Brucella microti CCM 4915]
 gi|82616742|emb|CAJ11827.1| SAM (and some other nucleotide) binding motif:N-6 Adenine-specific
           DNA methylase:N6 adenine-specific DNA methyltransferase,
           N [Brucella melitensis biovar Abortus 2308]
 gi|148371302|gb|ABQ61281.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brucella ovis ATCC 25840]
 gi|256000431|gb|ACU48830.1| hemK protein [Brucella microti CCM 4915]
          Length = 283

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 19  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 78

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 79  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 138

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 139 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 198

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 199 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 258

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 259 LAGEANDLGGHRRAMLFGQ 277


>gi|306844841|ref|ZP_07477424.1| glutamine-N5 methyltransferase, release factor-specific [Brucella
           sp. BO1]
 gi|306274773|gb|EFM56554.1| glutamine-N5 methyltransferase, release factor-specific [Brucella
           sp. BO1]
          Length = 295

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATCLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQIIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|161619786|ref|YP_001593673.1| HemK family methyltransferase [Brucella canis ATCC 23365]
 gi|254704886|ref|ZP_05166714.1| HemK family methyltransferase [Brucella suis bv. 3 str. 686]
 gi|260567640|ref|ZP_05838110.1| methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261755580|ref|ZP_05999289.1| modification methylase [Brucella suis bv. 3 str. 686]
 gi|161336597|gb|ABX62902.1| methyltransferase, HemK family [Brucella canis ATCC 23365]
 gi|260157158|gb|EEW92238.1| methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261745333|gb|EEY33259.1| modification methylase [Brucella suis bv. 3 str. 686]
          Length = 295

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE L++  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALMELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|17986476|ref|NP_539110.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260562789|ref|ZP_05833275.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|17982075|gb|AAL51374.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260152805|gb|EEW87897.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
          Length = 295

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALAKARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LAGEANDLGGHRRAMLFGQ 289


>gi|23502721|ref|NP_698848.1| hemK protein [Brucella suis 1330]
 gi|23348736|gb|AAN30763.1| hemK protein [Brucella suis 1330]
          Length = 283

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 19  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 78

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE L++  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 79  RLSAQTLEPRPDTEALMELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 138

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 139 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 198

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 199 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 258

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 259 LAGEANDLGGHRRAMLFGQ 277


>gi|256059848|ref|ZP_05450035.1| methyltransferase, HemK family protein [Brucella neotomae 5K33]
 gi|261323818|ref|ZP_05963015.1| modification methylase [Brucella neotomae 5K33]
 gi|261299798|gb|EEY03295.1| modification methylase [Brucella neotomae 5K33]
          Length = 295

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TG +   ++  P+ ++   +   L  A+ R    E +HRI+G R+FY +  
Sbjct: 31  DARLLIEWATGATRLDLVSQPEKLIGSAEAEKLRAALERRAGGEPVHRIMGQREFYGLPF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+ T EPRP+TE LV+  +      I +     +LD+GTGTGA+ ++LL       G+
Sbjct: 91  RLSAQTLEPRPDTEALVELVIPVLEQLIARHGTAEVLDMGTGTGAIIISLLHRFEHMHGI 150

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD++  AL  A+ NA+ NGV ERF  L+SDWFS+V G F +IVSNPPYI    +  L  
Sbjct: 151 GVDVAEGALATARINAIDNGVGERFAGLKSDWFSNVSGKFHLIVSNPPYIPHAEIAGLSR 210

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DP  +LDGG DGL  Y+ +A GV  +L KDG+ +VEIG  Q  DV  +F+S    
Sbjct: 211 EVREHDPLAALDGGPDGLDFYKALAQGVGAYLYKDGMVAVEIGAGQFQDVEALFKSTGFS 270

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           L     D GG+ R +LF +
Sbjct: 271 LACEANDLGGHRRAMLFGQ 289


>gi|227823187|ref|YP_002827159.1| putative modification methylase, HemK family [Sinorhizobium fredii
           NGR234]
 gi|227342188|gb|ACP26406.1| putative modification methylase, HemK family [Sinorhizobium fredii
           NGR234]
          Length = 298

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 105/212 (49%), Positives = 142/212 (66%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           ++RILG R+F+ +   LS +T EPRP+TE LVD  + +      ++   R++D+GTGTGA
Sbjct: 72  VYRILGEREFHGLTFRLSKETLEPRPDTETLVDCLIPYVRRIAARKGCCRLIDMGTGTGA 131

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           +CLALL  +   +G G DIS  AL  A+ NA  NG+++RF TL+SDWF +VEG FD+IVS
Sbjct: 132 ICLALLAAALEARGFGTDISEDALATARENAKRNGLADRFQTLRSDWFETVEGRFDIIVS 191

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S +V  L  EVR  DP  +LDGG DGL  YR IA    RHL  DG+  +EIG++
Sbjct: 192 NPPYIRSSVVGELEPEVRYHDPAAALDGGNDGLDVYRAIAQHAGRHLETDGVVGLEIGFD 251

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           QK  V  +F+++   L+ +  D GGNDRVL+F
Sbjct: 252 QKHAVTALFQAQGFRLLESAMDLGGNDRVLIF 283


>gi|319408171|emb|CBI81824.1| Methylase [Bartonella schoenbuchensis R1]
          Length = 288

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 147/258 (56%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  VTG +    I+ P+  L  +Q   L  AI R +  E  HRI+G RDFY + L
Sbjct: 28  DAKLLVEWVTGTTPTDRILQPNMRLSSKQIAQLKKAIQRRIAGEPTHRIIGKRDFYGISL 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           TLS DT EPRP+TE LVD  L     ++EK      LD+GTG+GA+ +A+LK+      +
Sbjct: 88  TLSQDTLEPRPDTETLVDLVLPILKKQVEKTGKATFLDMGTGSGAIAIAILKQIIQTYAI 147

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
            VDIS  AL+ A  NA    +++RF  L SDWF+SV G FD+IVSNPPYI    V  L  
Sbjct: 148 AVDISEDALKTATKNAKHADIAQRFTPLLSDWFTSVTGQFDLIVSNPPYIPEKDVQNLAK 207

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR  DP  +L GG DGL  YR +A   + HL +    +VEIGY+Q+ +V  +F+     
Sbjct: 208 EVRLHDPLRALVGGKDGLDFYRKLAHESANHLKEKAYVAVEIGYSQQKEVCDLFKKNGFE 267

Query: 246 LVNAFKDYGGNDRVLLFC 263
            +   KD  G  R LLF 
Sbjct: 268 YLKMRKDLNGIPRALLFS 285


>gi|153008372|ref|YP_001369587.1| HemK family modification methylase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560260|gb|ABS13758.1| modification methylase, HemK family [Ochrobactrum anthropi ATCC
           49188]
          Length = 287

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 155/254 (61%), Gaps = 8/254 (3%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
            TG +   +I  P+ ++D      L++A+ R  K E +HRI+G R+F+ +   LS+ T E
Sbjct: 33  ATGKTRLDLISAPEQLVDSAVIETLSDALDRREKGEPVHRIMGVREFFGLPFRLSAATLE 92

Query: 74  PRPETELLVDSALAFSLPRIE----KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           PRP+TE+LV+      +P +E    +++ + +LD+GTGTGA+ ++LL       G+G+D+
Sbjct: 93  PRPDTEVLVE----LVIPALEALAVQKNTLELLDMGTGTGAIIISLLHRFERTHGIGLDM 148

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRD 189
           +  AL +A+ NAV NGV +RF  L+SDWF +V G F +IVSNPPYI    +  L  EVR+
Sbjct: 149 AEGALAMARINAVANGVGDRFAALKSDWFENVSGRFHLIVSNPPYIPHEDIAGLSREVRE 208

Query: 190 FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNA 249
            DP  +LDGG DGL+ YR +A   + HL K G+ +VEIG  Q  DV  +FES    L   
Sbjct: 209 HDPLAALDGGSDGLNFYRALAQKAADHLYKQGMVAVEIGAGQFQDVEALFESAGFSLAGH 268

Query: 250 FKDYGGNDRVLLFC 263
             D GG+ R +LF 
Sbjct: 269 ASDLGGHRRAMLFA 282


>gi|239832946|ref|ZP_04681275.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ochrobactrum intermedium LMG 3301]
 gi|239825213|gb|EEQ96781.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ochrobactrum intermedium LMG 3301]
          Length = 290

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 151/250 (60%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
            TG +   +I  P+ ++D      L +A+ R  K E +HRI+G R+F+ +   LS++T E
Sbjct: 36  ATGRTRLDLISAPEQLVDGAAIQTLCDALERRAKGEPVHRIMGVREFFGLPFRLSTETLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LV+  +       ++ + + +LD+GTGTGA+ ++LL       GVG+D++  A
Sbjct: 96  PRPDTEALVELVIPALDVLAQQENTLELLDMGTGTGAIIISLLHRFERAHGVGLDMAEGA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L +A+ NA+ NGV +RF  L+SDWF  V G F +IVSNPPYI    +  L  EVR+ DP 
Sbjct: 156 LVMARINAIANGVGDRFAALKSDWFQHVSGRFHLIVSNPPYIPHEDIAGLSREVREHDPL 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +LDGG+DGL+ YR +A   + HL + G+ +VEIG  Q  DV  +FES    L     D 
Sbjct: 216 AALDGGVDGLNFYRALAQKAADHLYRKGMVAVEIGAGQFQDVEALFESAGFSLAGHASDL 275

Query: 254 GGNDRVLLFC 263
           GG+ R +LF 
Sbjct: 276 GGHRRAMLFA 285


>gi|240849862|ref|YP_002971250.1| protoporphyrinogen oxidase protein [Bartonella grahamii as4aup]
 gi|240266985|gb|ACS50573.1| protoporphyrinogen oxidase protein [Bartonella grahamii as4aup]
          Length = 288

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 148/258 (57%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  +TG+++ + I  PD  L       +  A+ R +  E ++RI+G R+FY +  
Sbjct: 28  DAKILVEWITGINAAERISKPDMHLSSEHIIQIEQALQRRIAGEPVYRIIGAREFYGISF 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           TLS +T EPRP+TE L+D  L F   ++E       LD+GTG+GA+ + LLK+ P    V
Sbjct: 88  TLSQETLEPRPDTETLIDLVLPFLQKQVENSGRTTFLDMGTGSGAIAITLLKQIPQSYAV 147

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
            VDIS  AL+ AK NA    V+ RF  L SDWF +V   FD IVSNPPYI +  +  L  
Sbjct: 148 AVDISEDALKTAKKNAKNAEVAHRFTPLLSDWFDAVADRFDFIVSNPPYIPAQDIKKLAK 207

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR +DP  +L GG DGL  YR +A   + +L ++G  +VEIGY+Q+ +V  +F+     
Sbjct: 208 EVRLYDPLRALMGGEDGLYFYRKLAHEAANYLKENGYVAVEIGYSQENEVCNLFKKNGFQ 267

Query: 246 LVNAFKDYGGNDRVLLFC 263
            +   KD  G  R LLF 
Sbjct: 268 CLEVRKDLSGIPRALLFA 285


>gi|319407579|emb|CBI81229.1| Methylase [Bartonella sp. 1-1C]
          Length = 288

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 145/250 (58%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           +TG ++   I+ P+  L  +Q   L  AI R +  E ++RI+G R+FY +  TLS DT E
Sbjct: 36  ITGTTASDRILQPNMYLSSQQLVQLEQAINRRIAGEPVYRIIGTREFYGIPFTLSKDTLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LVD  L      +EK +   +LD+GTG+GA+ +A+LK+ P    V VDIS  A
Sbjct: 96  PRPDTETLVDLVLPILKSHLEKSEQATLLDMGTGSGAIAIAILKQIPQTYAVAVDISEDA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L+ A  NA    V+ RF  L S+WF S++G FD+I+SNPPYI    +  L  EVR  DP 
Sbjct: 156 LKTATKNAQHANVAHRFTPLLSNWFDSIKGQFDLIISNPPYIPEKEIKNLAKEVRQHDPW 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L+GG DGL  YR +A   + +L +    +VEIGY+Q+  V  +FE      +   +D 
Sbjct: 216 CALNGGEDGLYFYRKLAYESANYLKEKSYIAVEIGYSQEKKVRDLFEKNGFKCLKIREDL 275

Query: 254 GGNDRVLLFC 263
               R LLF 
Sbjct: 276 NRIPRALLFS 285


>gi|319404589|emb|CBI78195.1| Methylase [Bartonella rochalimae ATCC BAA-1498]
          Length = 288

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 145/250 (58%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           +TG ++   I+ P+  L  +Q   L  AI R +  E ++RI+G R+FY +  TLS DT E
Sbjct: 36  ITGTTASDRILQPNMYLSSQQLVQLEQAINRRIAGEPVYRIIGTREFYGIPFTLSKDTLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LVD  L      +EK +   +LD+GTG+GA+ +A+LK+ P    V VDIS  A
Sbjct: 96  PRPDTETLVDLVLPILKSHLEKSEQATLLDMGTGSGAIAIAILKQIPQTYAVAVDISEDA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L+ A  NA    V+ RF  L S+WF S++G FD+I+SNPPYI    +  L  EVR  DP 
Sbjct: 156 LKTATKNAQHANVAHRFIPLLSNWFDSIKGQFDLIISNPPYIPEKEIKNLAKEVRQHDPW 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L+GG DGL  YR +A   + +L +    +VEIGY+Q+  V  +FE      +   +D 
Sbjct: 216 RALNGGEDGLYFYRKLAYESANYLKEKSYIAVEIGYSQEKKVRDLFEKNGFKCLKIREDL 275

Query: 254 GGNDRVLLFC 263
               R LLF 
Sbjct: 276 NKIPRALLFS 285


>gi|170742858|ref|YP_001771513.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium sp. 4-46]
 gi|168197132|gb|ACA19079.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium sp. 4-46]
          Length = 295

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 151/259 (58%), Gaps = 3/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G+S   +++  D  LD+ Q   L+ A+ R    E + RILG  +F+ +  
Sbjct: 33  DARLILTETLGVSRVDLLLGADGPLDEAQARSLSAALRRRASGEPVARILGAWEFWGLPF 92

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS DT  PRP+TE LV++AL    PR      +R+LDLGTG+G + +ALL E P  +GV
Sbjct: 93  RLSPDTLVPRPDTETLVEAALDLGHPRDA---ALRLLDLGTGSGCLLVALLSEWPRAEGV 149

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+D+S +AL  A++NA  NGV  R   L+ DW +++ G FDV V+NPPYI + ++  L  
Sbjct: 150 GIDLSLEALRTARANAARNGVGARAAWLRGDWAAALAGRFDVAVANPPYIAANLIPGLAP 209

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRD DPR++LDGG DGL  YR I    +  L   G   VEIGY+Q+  +  + E+  L 
Sbjct: 210 EVRDHDPRLALDGGADGLDCYRVILAQAADFLAPGGHLVVEIGYDQEEALRHLAEAAGLR 269

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           +V   +D  G+ R  L  R
Sbjct: 270 VVVVRRDLAGHPRAALLAR 288


>gi|319899229|ref|YP_004159322.1| Methylase [Bartonella clarridgeiae 73]
 gi|319403193|emb|CBI76752.1| Methylase [Bartonella clarridgeiae 73]
          Length = 288

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/249 (40%), Positives = 143/249 (57%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           +TG ++   I+ P+  L  +Q   L  AI R +  E ++RI+G R+FY +   LS DT E
Sbjct: 36  ITGTNASDRILRPNMCLSSKQLVQLEQAINRRIAGEPVYRIIGTREFYGIPFALSKDTLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LVD  +      +EK +   +LD+GTG+GA+ +A+LK+ P    V VDIS  A
Sbjct: 96  PRPDTETLVDLVVPILKTHLEKSEQATLLDMGTGSGAIAIAILKQIPQTYAVAVDISEDA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L+ A  NA    V+ RF  L S+WF S++G FD+I+SNPPYI    +  L  EVR  DP 
Sbjct: 156 LKTATKNAQHANVAHRFAPLLSNWFDSIKGQFDLIISNPPYIPEKEIKNLAKEVRQHDPL 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L GG DGL  YR +A     +L + G  +VEI Y+Q+  V  +FE      +   +D 
Sbjct: 216 RALIGGKDGLDFYRKLAHESENYLKEKGHIAVEISYSQEKKVCDLFEKNGFKCLKIREDL 275

Query: 254 GGNDRVLLF 262
            G  R LLF
Sbjct: 276 NGIPRALLF 284


>gi|319406094|emb|CBI79724.1| Methylase [Bartonella sp. AR 15-3]
          Length = 288

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 144/249 (57%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           VTG ++   I+ P+  L   Q   L  AI R +  E ++RI+G R+FY +  TLS DT E
Sbjct: 36  VTGTTASDRILQPNMCLSSEQLVQLEQAINRRIAGEPVYRIIGTREFYGIPFTLSKDTLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE +VD  L      +EK +   +LD+GTG+GA+ +A+LK+ P    V VDIS  A
Sbjct: 96  PRPDTETVVDLVLPILKTYLEKSEQATLLDMGTGSGAIAIAILKQIPQTYAVAVDISEDA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L+ A  NA    V+ RF  L S+WF SV+G FD+I+SNPPYI    +  L  EVR  DP 
Sbjct: 156 LKTATKNAQHANVAHRFTPLLSNWFDSVKGQFDLIISNPPYIPEKEIKNLAKEVRQHDPL 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L GG DGL  YR +A   + +L +    +VEIGY+Q+ +V  +F+      +   +D 
Sbjct: 216 RALIGGKDGLDFYRKLAHESANYLKEKSYIAVEIGYSQEKEVCDLFKKNGFKCLKIREDL 275

Query: 254 GGNDRVLLF 262
               R LLF
Sbjct: 276 NRIPRALLF 284


>gi|121601994|ref|YP_988677.1| HemK family methyltransferase [Bartonella bacilliformis KC583]
 gi|120614171|gb|ABM44772.1| methyltransferase, HemK family [Bartonella bacilliformis KC583]
          Length = 288

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/261 (40%), Positives = 150/261 (57%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   +  VT  S+   I+ PD  L  +Q   L  AI R +  E  HRI+G R+FY
Sbjct: 24  EANLDTKLLVEWVTSTSTIDRILQPDMCLSSQQIAQLEEAIKRRISGEPTHRIIGTREFY 83

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
            +   LS +T EPRP+TE+L+D  L     +++K     +LD+GTGTGA+ +A+LK+   
Sbjct: 84  GISFALSKETLEPRPDTEILIDLVLPILKKKVKKSGKATLLDMGTGTGAIAIAILKQVVQ 143

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
              V VDI+  AL+ A  NA    V  RF  L S+WF++V G FD+I+SNPPYI    + 
Sbjct: 144 TCAVAVDIAEDALKTATQNAKNADVLHRFTPLLSNWFNTVTGQFDLIISNPPYIPEKDIP 203

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR +DP  +L GG DGL  YR +AD  + +L ++G  +VEIGY+QK +V  +FE 
Sbjct: 204 NLAKEVRQYDPLRALIGGKDGLDFYRKLADESATYLKEEGYIAVEIGYSQKKEVCNLFEK 263

Query: 242 RKLFLVNAFKDYGGNDRVLLF 262
                +    D  G  R +LF
Sbjct: 264 NGFKCLKIRDDLSGIPRAILF 284


>gi|220920162|ref|YP_002495463.1| modification methylase, HemK family [Methylobacterium nodulans ORS
           2060]
 gi|219944768|gb|ACL55160.1| modification methylase, HemK family [Methylobacterium nodulans ORS
           2060]
          Length = 299

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 155/262 (59%), Gaps = 3/262 (1%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A+RD+   L     L S  +++  D  L+ R+   L+ A++R  + E + RILG  +F+ 
Sbjct: 30  AMRDARLLLIETLNLRSIDLVLAGDRELEAREAARLSAALLRRAEGEPVARILGAWEFWG 89

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +   LS  T  PRP+TE +V++ALA  L   E+   +R+LDLGTG+G + +ALL E P  
Sbjct: 90  LPFRLSPATLVPRPDTETVVEAALALGL---ERTAPIRLLDLGTGSGCLLVALLSEWPCA 146

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
            G+G+D + +AL  A+ NA  NGV  R   +Q DW  S+ G FDVIV+NPPYI S ++D 
Sbjct: 147 TGLGIDRAREALVTARDNADQNGVGARALWVQGDWAGSLRGPFDVIVANPPYIASRMIDG 206

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EVR  DPR++LDGG DGL  YR I    +  L   G   VEIGY+Q+  +  + E+ 
Sbjct: 207 LADEVRVHDPRMALDGGSDGLDAYRVILGQAAVLLAPGGRLIVEIGYDQEEALRHLAEAA 266

Query: 243 KLFLVNAFKDYGGNDRVLLFCR 264
           +L +V   +D  G+ R ++  R
Sbjct: 267 RLQVVVVRRDLAGHPRAVVMAR 288


>gi|163867490|ref|YP_001608689.1| methylase [Bartonella tribocorum CIP 105476]
 gi|161017136|emb|CAK00694.1| Methylase [Bartonella tribocorum CIP 105476]
          Length = 288

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 147/263 (55%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           ++A  D+   +  +TG+++   I  PD  L       +  AI R +  E ++RI+G R+F
Sbjct: 23  LEADLDAKVLVEWITGINAATRISKPDMHLSSEHIRQIEQAIKRRIAGEPVYRIIGAREF 82

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           Y +   LS +T EPRP+TE L+D  L F   +++       LD+GTG+GA+ +A+LK+ P
Sbjct: 83  YGISFALSQETLEPRPDTETLIDLVLPFLKKQVKNSKKTTFLDMGTGSGAIAIAILKQIP 142

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
               V VDIS  AL+ A  NA    V  RF  L SDWF SV   FD IVSNPPYI    +
Sbjct: 143 QSYAVAVDISEDALKTATKNAKNADVIHRFTPLLSDWFDSVTDRFDFIVSNPPYIPEKDI 202

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           + L  EVR  DP  +L GG DGL  YR +A   + +L ++G  +VEIGY+Q+ +V  +F+
Sbjct: 203 NKLAKEVRLHDPLRALIGGKDGLDFYRKLAHEAANYLKENGTIAVEIGYSQEKEVCDLFK 262

Query: 241 SRKLFLVNAFKDYGGNDRVLLFC 263
                 +   KD  G  R LLF 
Sbjct: 263 KNGFQCLEMRKDLNGIPRALLFA 285


>gi|49475008|ref|YP_033049.1| protoporphyrinogen oxidase protein [Bartonella henselae str.
           Houston-1]
 gi|49237813|emb|CAF27008.1| Protoporphyrinogen oxidase protein [Bartonella henselae str.
           Houston-1]
          Length = 288

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 138/240 (57%)

Query: 23  IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLV 82
           ++ PD  L   Q   L  AI R +  E ++RI+G R+FY +   LS +T EPR +TE LV
Sbjct: 45  VLQPDLCLSFEQILQLEKAIQRRIAGEPVYRIIGKREFYGISFALSQETLEPRSDTETLV 104

Query: 83  DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
           D  L       EK + + +LD+GTG+GA+ +A+LK+ P    V VDIS  AL+ A  NA 
Sbjct: 105 DLVLPPLKKYGEKSEKITLLDMGTGSGAIAIAILKQIPQSYAVAVDISENALKTATKNAK 164

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
           +  V  RF  L SDWF SV G FD+I+SNPPYI    +  L  EV   DP  +L GG DG
Sbjct: 165 SAKVINRFTPLLSDWFDSVTGQFDLIISNPPYIPETDITKLAKEVHLHDPLRALIGGKDG 224

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           L  YR ++D  + +L + G  +VEIGY+Q+ +V  +FE      +   KD  G  R LLF
Sbjct: 225 LDFYRKLSDKAANYLKEKGSIAVEIGYSQEKEVCDLFEKNGFKCLEMRKDLNGIPRALLF 284


>gi|49473851|ref|YP_031893.1| protoporphyrinogen oxidase protein [Bartonella quintana str.
           Toulouse]
 gi|49239354|emb|CAF25687.1| Protoporphyrinogen oxidase protein [Bartonella quintana str.
           Toulouse]
          Length = 288

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 139/250 (55%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           +TG ++   I+ PD  L   Q   L  AI R +  E ++RI+G R+FY +   LS +T E
Sbjct: 36  ITGTNASVRILHPDLCLSFEQITQLEQAIQRRINGEPVYRIIGKREFYGISFALSQETLE 95

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LVD  L      ++K     +LD+GTG+GA+ +A+LK+ P      VDIS  A
Sbjct: 96  PRPDTETLVDLVLPLLKKYVDKLGKTTLLDMGTGSGAIAIAILKQIPQSYATAVDISKDA 155

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L+ A  NA    V  RF  L S+WF SV   FD+I+SNPPYI    +  L  EVR  DP 
Sbjct: 156 LKTAIKNAKNAKVIHRFTPLLSNWFDSVTDRFDLIISNPPYIPETDIKNLAKEVRLHDPL 215

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L GG DGL  YR +A   + +L   G  +VEIG++Q+ +V  +FE      +   +D 
Sbjct: 216 RALIGGKDGLHFYRKLAHEATNYLKTKGSLAVEIGHSQEKEVCDLFEKNGFQFLEMRRDL 275

Query: 254 GGNDRVLLFC 263
            G  R LLF 
Sbjct: 276 SGIPRALLFT 285


>gi|254420535|ref|ZP_05034259.1| ribosomal protein L11 methyltransferase [Brevundimonas sp. BAL3]
 gi|196186712|gb|EDX81688.1| ribosomal protein L11 methyltransferase [Brevundimonas sp. BAL3]
          Length = 304

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G S   ++ DP  V+   Q       I R LK E + RI+G + F+ + L
Sbjct: 39  DARLLLEAAAGASRMDILTDPYRVVTPEQHTAYEAMIDRRLKREPVSRIVGKKGFWKIML 98

Query: 66  TLSSDTFEPRPETELLVDSA-LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            ++ D   PRP+TE L+D A LAF+     +      +DLGTG+GA+ LALL E P   G
Sbjct: 99  NVTPDVLSPRPDTETLMDVAMLAFA-----RTQAFSAIDLGTGSGAILLALLAERPAAHG 153

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           VG DIS +AL +AK NA    +++R   L+++W +   +  FD+++SNPPYI +  +  L
Sbjct: 154 VGTDISTEALAVAKENAANLDLNDRAAFLRTEWAAGFGDASFDLVLSNPPYIPTDHIPTL 213

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVRD DP ++LDGG DGL  YR +A  V R L   G+ +VEIG++Q   V  +FE++ 
Sbjct: 214 DPEVRDHDPHLALDGGPDGLQAYRDLAPEVKRILKPGGVFAVEIGWDQGPQVKALFEAQG 273

Query: 244 LFLVNAFKDYGGNDRVL 260
              V   KD G  DRV+
Sbjct: 274 FADVKVVKDLGERDRVV 290


>gi|302381613|ref|YP_003817436.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302192241|gb|ADK99812.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 294

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 147/257 (57%), Gaps = 7/257 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   +G S   ++ DP   L   Q+  L   + R L+ E + RILG + F+ + L
Sbjct: 29  DARLLLEAASGASRLDILTDPHRPLTPDQQAALAGYLERRLRREPVSRILGRKGFWKIML 88

Query: 66  TLSSDTFEPRPETELLVDSA-LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            ++ D   PRP+TE ++D A LAF     E      ++DLGTG+GA+ LA+L E P   G
Sbjct: 89  NVTPDVLSPRPDTETILDVAMLAF-----EPAQAFNVIDLGTGSGAILLAVLSERPGSHG 143

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           VG DIS +AL +A+ NA   G+  R   L+++W +   +  FD++VSNPPYI S  +  L
Sbjct: 144 VGTDISSEALAVARENAANLGLDGRATFLRTEWAAGFGDASFDLVVSNPPYIPSGDIPGL 203

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVRD DP ++LDGG DGL  YR +A  ++R L   G+ +VEIG++Q   V  +FE+  
Sbjct: 204 DPEVRDHDPVLALDGGPDGLQAYRDLAPEIARILKPGGVFAVEIGWDQGPQVKALFEAAG 263

Query: 244 LFLVNAFKDYGGNDRVL 260
           L  V   KD G   RV+
Sbjct: 264 LTDVKVVKDLGDRHRVV 280


>gi|114704326|ref|ZP_01437234.1| protoporphyrinogen oxidase [Fulvimarina pelagi HTCC2506]
 gi|114539111|gb|EAU42231.1| protoporphyrinogen oxidase [Fulvimarina pelagi HTCC2506]
          Length = 298

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/248 (42%), Positives = 144/248 (58%), Gaps = 7/248 (2%)

Query: 17  LSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRP 76
           L+  +  ++PD+     +RF  T  I R    E +HRILG R FY     LS+ T EPRP
Sbjct: 49  LARRERPIEPDA----EERF--TAYISRRRSGEPVHRILGKRGFYGHDFELSAGTLEPRP 102

Query: 77  ETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEI 136
           +TE++V+  +AF L  +++   +R+LD+GTG+G + L++L   P     G DIS  AL  
Sbjct: 103 DTEIVVEMGIAF-LRTVDRDRPLRVLDIGTGSGVIALSILVALPHTHAFGTDISEDALAT 161

Query: 137 AKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISL 196
           A+ NA    V  RF+T  +D+ + + G  D+ +SNPPYI +  +  L  EVRDFDP+ +L
Sbjct: 162 ARRNAKRLKVDARFETSVTDYAAGITGPLDLAISNPPYIATRDIAGLSSEVRDFDPKSAL 221

Query: 197 DGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGN 256
           DGG DGL  YR IA  V   L  DG   VEIG +QK  V RIFE+    L +  KDYGG 
Sbjct: 222 DGGEDGLKAYRAIAAQVRSVLADDGSVVVEIGIDQKDPVTRIFEACGFTLSDWRKDYGGI 281

Query: 257 DRVLLFCR 264
            R L F R
Sbjct: 282 VRALRFSR 289


>gi|115522191|ref|YP_779102.1| HemK family modification methylase [Rhodopseudomonas palustris
           BisA53]
 gi|115516138|gb|ABJ04122.1| modification methylase, HemK family [Rhodopseudomonas palustris
           BisA53]
          Length = 313

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 142/250 (56%), Gaps = 1/250 (0%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  V GL   Q+++  + VL   Q   L +   R +  E + RILG ++F+ + L
Sbjct: 53  DARLLVGEVAGLDLTQLVLAAERVLTPEQAIRLEDFARRRIAGEPVARILGHQEFWGLTL 112

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS DT  PRP+TE +V++AL  +    + R  +RI DLGTGTGA+ LALL E P  +GV
Sbjct: 113 QLSPDTLVPRPDTETMVEAALDLARDWTD-RAALRIADLGTGTGAILLALLSEWPNARGV 171

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             D+SC+AL  A+ NA   G+  R   +  D+ ++++G FD+IVSNPPYI +  +  L +
Sbjct: 172 ATDLSCEALRTARGNADRLGLGARTRFVACDYAAALKGPFDLIVSNPPYIPAAEIATLAV 231

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV D DPR +LDGG DGL  YR IA   +  L+  G   VE+G  Q   V  +  +  L 
Sbjct: 232 EVSDHDPRRALDGGDDGLDAYRAIAPQAAALLSPGGALIVEVGQGQSEPVAGLMAASGLT 291

Query: 246 LVNAFKDYGG 255
           L     D GG
Sbjct: 292 LDAPRPDLGG 301


>gi|170746588|ref|YP_001752848.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653110|gb|ACB22165.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium radiotolerans JCM 2831]
          Length = 299

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 144/263 (54%), Gaps = 3/263 (1%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L  + GL +  +++D    L       L  A+ R L  E + RILG  +F+
Sbjct: 29  EAAGDARFLLLGILGLETRDLLIDGSRRLGPADAASLAAALARRLAGEPVARILGAWEFW 88

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
            +   L  DT  PRP+TE+LV+ ALA    R ++   +R LDLGTG+G +  ALL E P 
Sbjct: 89  GLPFRLGPDTLVPRPDTEILVEVALAA---RPDRAAPLRCLDLGTGSGCILTALLSERPR 145

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             GVG+D S  AL +A+ NAVTNGV +R   +  DW  ++ G FD++VSNPPYI   ++ 
Sbjct: 146 ATGVGLDRSEGALRVARDNAVTNGVGDRARFVAGDWCDALWGCFDLVVSNPPYIARAVIG 205

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR  DP  +LDGG DGL  YR I  G    L   GL  +EIGY+Q   V  +  +
Sbjct: 206 TLEREVRGHDPAAALDGGADGLEAYRRILGGAGACLATGGLLVLEIGYDQAAAVTDLARA 265

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
                    +D  G+DRVL F R
Sbjct: 266 AGYRARGLTRDLAGHDRVLSFDR 288


>gi|92116090|ref|YP_575819.1| HemK family modification methylase [Nitrobacter hamburgensis X14]
 gi|91798984|gb|ABE61359.1| [protein release factor]-glutamine N5-methyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 317

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 128/218 (58%), Gaps = 1/218 (0%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E + RILG +DF+ + L LS+DT  PRP+TE +V++AL         R  +RI D
Sbjct: 93  RRLAGEPVARILGTKDFWGLPLKLSADTLVPRPDTETVVEAALEILRAEGRTRTPLRIAD 152

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           LGTG+GA+ LALL E P   GVG D+S  AL+ AK+NA   G++ R D   SD+   +  
Sbjct: 153 LGTGSGAILLALLSELPDATGVGTDLSAAALDTAKANAQRLGLAPRADFTVSDYAGGLSD 212

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI S  +  L  EVRD DP ++LDGG DGL  YR IA   +  L   GL 
Sbjct: 213 PFDLIVSNPPYIRSADIASLAPEVRDHDPHLALDGGSDGLEAYRRIAPQAAGLLAPGGLL 272

Query: 224 SVEIGYNQKVDVVRIFESRKLFLVN-AFKDYGGNDRVL 260
            +E+G  Q  DVVR+  +  L +   A  D  G  R +
Sbjct: 273 VLEVGQGQDGDVVRLVAAAGLTVAGPARADLAGIGRAV 310


>gi|163759876|ref|ZP_02166960.1| putative methyltransferase protein [Hoeflea phototrophica DFL-43]
 gi|162282834|gb|EDQ33121.1| putative methyltransferase protein [Hoeflea phototrophica DFL-43]
          Length = 294

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 145/258 (56%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   + R+  L+SHQ+  + D  L D  R  +  A    L  + +HRILG RDFY + L
Sbjct: 35  DARLLISRLADLASHQLATNGDLPLTDAVRGKIERAAGERLAGKPVHRILGTRDFYGLSL 94

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS  T EPRP+TE L+D+ L F   R+ +     I+DLG G G + LAL+ E    + +
Sbjct: 95  KLSGATLEPRPDTETLIDAVLPFVHDRVVQTGCCEIVDLGIGAGGIGLALVAECTQARCL 154

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+D+S +A+  A +NA   G+S R+  +  DWF  VE  FD+IVSNPPYI +  +  L  
Sbjct: 155 GIDVSLEAVTTALTNARELGLSARYSAVTGDWFRGVEQHFDLIVSNPPYIPTADIASLSR 214

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV   DP ++LDGG DGL  YR IA      L   G  ++EIG  Q+  V  +F +++  
Sbjct: 215 EVVAHDPLLALDGGKDGLDAYRQIAAQCRTRLKSGGQVALEIGVGQRKSVTELFVAQRFE 274

Query: 246 LVNAFKDYGGNDRVLLFC 263
           L     D GG DRVL+F 
Sbjct: 275 LSQVVADLGGVDRVLVFA 292


>gi|295690768|ref|YP_003594461.1| protein-(glutamine-N5) methyltransferase [Caulobacter segnis ATCC
           21756]
 gi|295432671|gb|ADG11843.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Caulobacter segnis ATCC 21756]
          Length = 289

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 145/259 (55%), Gaps = 11/259 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G++  +++ DP   L   Q   L   + R  + E +  I+G + F+ + L
Sbjct: 27  DARLMLEVAAGVTRTEIVTDPYRELTAEQAAMLDEFLTRRARREPVSHIIGRKGFWKILL 86

Query: 66  TLSSDTFEPRPETELLVDSAL-AF--SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
            ++ +   PRPETE++VD  L AF  ++P         +LDLG G+G + LA+L E P  
Sbjct: 87  QVNKNVLTPRPETEVIVDEVLKAFPEAMP-------FSMLDLGVGSGTILLAVLAERPAA 139

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVD 181
           KG+GVD S +AL +A+ NA    ++ R   L  DW + + +  FD++ SNPPYI S +++
Sbjct: 140 KGLGVDASSEALAVARDNAANLDLNNRATFLHGDWTAGLADASFDLVASNPPYIPSAVIE 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVRD +PR++LDGG DGL  YR +A  + R L   G+ +VEIGY+Q   V  +F +
Sbjct: 200 TLEPEVRDHEPRLALDGGADGLDAYRLLAPEILRVLKPGGMFAVEIGYDQSKAVESLFNA 259

Query: 242 RKLFLVNAFKDYGGNDRVL 260
                V   KD   +DRV+
Sbjct: 260 AGAQQVRTTKDLSTHDRVV 278


>gi|83592090|ref|YP_425842.1| modification methylase HemK [Rhodospirillum rubrum ATCC 11170]
 gi|83575004|gb|ABC21555.1| Modification methylase HemK [Rhodospirillum rubrum ATCC 11170]
          Length = 325

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 138/260 (53%), Gaps = 5/260 (1%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+      V GLS   V++  D V+   +   L   I R    E + RILG R F+   
Sbjct: 46  RDARLLAGHVLGLSPGAVLLADDRVVTPEEAQALEAVIARRETREPVSRILGHRGFWRFD 105

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L L +DT +PRP+TE LV++ LA     + +    RILDLGTG+G + LALL + P   G
Sbjct: 106 LALGADTLDPRPDTETLVEAGLA-----VLEGCGGRILDLGTGSGCILLALLADRPGAIG 160

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +G+DI+  A+ +A  NA   G+  R      DW ++V G FD+IVSNPPYI S  +  L 
Sbjct: 161 LGIDIAPGAVRVALRNARALGLERRALFAVGDWAAAVAGPFDLIVSNPPYIPSADIAALE 220

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV  FDP  +LDGG DGL  YR +A  V   L   G+ +VE G  Q  DV  + E   L
Sbjct: 221 PEVARFDPSRALDGGADGLDPYRILAAQVPALLAPAGVLAVEFGQGQARDVAGLLEVGGL 280

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
                 KD  G +R LL  R
Sbjct: 281 CPYEIKKDLSGEERCLLARR 300


>gi|91974578|ref|YP_567237.1| HemK family modification methylase [Rhodopseudomonas palustris
           BisB5]
 gi|91681034|gb|ABE37336.1| modification methylase, HemK family [Rhodopseudomonas palustris
           BisB5]
          Length = 292

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 107/257 (41%), Positives = 141/257 (54%), Gaps = 3/257 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  VTGL    +IV  + +L   Q   L   + R L  E + RILG R+F+ + L
Sbjct: 32  DARLLIGEVTGLDLTGLIVQAERLLAPDQAELLDGFVARRLAGEPVARILGAREFWGLPL 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           TLS+DT  PRP+TE +V+ AL +   R E      ILD+G G+GA+ LALL E P   GV
Sbjct: 92  TLSADTLVPRPDTETVVEVALEYL--RAEAPARPLILDIGAGSGAILLALLSECPAAFGV 149

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS  AL  A+SNA+  G+S R      D+ S++ G FD+IVSNPPYI +  +  L  
Sbjct: 150 ATDISLGALRAAQSNAIRLGLSNRAGFAVCDYASALIGPFDLIVSNPPYIPARDIAALDR 209

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRD DPR +LDGG DGL  YR I     R L   G   VE G  Q  +V  +  +  L 
Sbjct: 210 EVRDHDPRRALDGGDDGLDAYRRIVPESMRLLRPGGALVVEFGQGQSDEVAALMRAAGLT 269

Query: 246 LVNAF-KDYGGNDRVLL 261
           +     +D GG  R L+
Sbjct: 270 VSGPPRRDLGGIFRALM 286


>gi|197104293|ref|YP_002129670.1| modification methylase HemK [Phenylobacterium zucineum HLK1]
 gi|196477713|gb|ACG77241.1| modification methylase HemK [Phenylobacterium zucineum HLK1]
          Length = 287

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 142/245 (57%), Gaps = 7/245 (2%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++ DP   L   Q   L + + R  K E +  ILG + F+ + L ++ D   PRP+TE +
Sbjct: 43  IVTDPYRPLTPEQEARLQDYLARREKREPVSHILGRKGFWKIMLRVTPDVLTPRPDTETV 102

Query: 82  VDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN 140
           VD AL AF      +     +LDLG G+GA+ LA+L E P  KG+G+D S +AL +A+ N
Sbjct: 103 VDVALKAFP-----EHAPWSVLDLGVGSGAILLAILAERPAAKGLGIDASEEALAVARDN 157

Query: 141 AVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGG 199
           A   G++ R   L+ DW + + +  FD++VSNPPYI S +++ L  EV+D++PR++L+GG
Sbjct: 158 AAALGLAGRTALLRGDWTAGLGDSAFDLVVSNPPYIASDVLETLEPEVKDYEPRLALEGG 217

Query: 200 IDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            DGL  YR +A  + R L   G  +VEIGY+QK  V  +F +     V   +D    DRV
Sbjct: 218 ADGLDAYRILAPEIVRVLKPGGRFAVEIGYDQKDAVEALFRAAGAEDVRTIRDLADRDRV 277

Query: 260 LLFCR 264
           +   +
Sbjct: 278 VAGAK 282


>gi|192289041|ref|YP_001989646.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodopseudomonas palustris TIE-1]
 gi|192282790|gb|ACE99170.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodopseudomonas palustris TIE-1]
          Length = 289

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 140/246 (56%), Gaps = 2/246 (0%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  V GL    +++  + +L   +   L +   R L+ E + RILG R+F+ +  
Sbjct: 29  DARLLVGEVAGLDLTGLLIQAERILTAEENEQLQSFAARRLRGEPVARILGMREFWGLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+DT  PRP+TE +V++ALA    R       RILD+GTG+GA+ LALL E P   GV
Sbjct: 89  ELSADTLVPRPDTETIVEAALAILAERSSL--APRILDIGTGSGAILLALLHECPDAVGV 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS  AL  A+ NA   G+++R   +  D+ S++ G FD+IVSNPPYI    +  L  
Sbjct: 147 ATDISLGALRTARGNAQRLGLADRACFVACDYASALRGPFDLIVSNPPYIPGNEIAALDR 206

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRD DPR +LDGG DGL  YR I     R L   G+  VEIG  Q+ DV  + ++  L 
Sbjct: 207 EVRDHDPRRALDGGADGLDAYRKIIPESVRLLQPGGVLVVEIGQGQEGDVSALMQASGLT 266

Query: 246 LVNAFK 251
           + + F+
Sbjct: 267 VSDPFR 272


>gi|146277161|ref|YP_001167320.1| HemK family modification methylase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555402|gb|ABP70015.1| modification methylase, HemK family [Rhodobacter sphaeroides ATCC
           17025]
          Length = 278

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 143/259 (55%), Gaps = 10/259 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVD-PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           A RD+   +    G++  ++ +  PD +L +    F      R+ + + + +I+G R F+
Sbjct: 22  APRDARRLMAHALGIAPDRITLHLPDPLLPEADARFEAALAARTAR-QPVAQIVGERLFW 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
                ++ DT +PRPETE L+++ALA             +LDLGTGTG + + LL E P 
Sbjct: 81  GRPFRVTRDTLDPRPETECLIEAALAAPF--------ATLLDLGTGTGCIAITLLAERPA 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
            +GV  D+S  AL +A+ NA+  GV++R D  +SDWF++V   FD+I+SNPPYI +  + 
Sbjct: 133 ARGVATDLSPAALAVAEGNALALGVADRLDCRRSDWFAAVPERFDLILSNPPYIAAHEMA 192

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR+++PR++L    DGL  YR I  G S HL   G   +EIG  Q  DV  +  S
Sbjct: 193 ELAPEVREWEPRMALTPEGDGLDAYRAITAGASAHLAPGGRLLLEIGAGQGADVAGLCAS 252

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V    D  G DR++
Sbjct: 253 AGLTEVRILPDLDGRDRLV 271


>gi|221233855|ref|YP_002516291.1| peptide release factor-glutamine N5-methyltransferase [Caulobacter
           crescentus NA1000]
 gi|220963027|gb|ACL94383.1| peptide release factor-glutamine N5-methyltransferase [Caulobacter
           crescentus NA1000]
          Length = 289

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 146/261 (55%), Gaps = 7/261 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G++  +++ DP   L   Q   L + + R  + E +  I+G + F+ + L
Sbjct: 27  DARLMLEVAAGVTRTEIVTDPYRELSAEQIATLNDYLERRARREPVSHIIGRKGFWKILL 86

Query: 66  TLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            ++ +   PRPETE++VD  L AF      +     +LDLG G+G + LA+L E P  KG
Sbjct: 87  QVNKNVLTPRPETEVIVDEVLKAFP-----EHMAFSMLDLGVGSGTILLAVLAERPAAKG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +G+D S +AL +A+ NA    ++ R   L  DW + +    FD++VSNPPYI + ++D L
Sbjct: 142 LGIDASSEALAVARENAANLDLNTRAALLHGDWTTGLGSDSFDLVVSNPPYIPTEVIDTL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +PR++LDGG DGL+ YR +A  + R L   GL +VEIGY+Q   V  +F +  
Sbjct: 202 EPEVRIHEPRLALDGGPDGLAAYRELAPEILRVLKPGGLFAVEIGYDQSQAVEALFRAAG 261

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              V   KD   +DRV+L  +
Sbjct: 262 ATEVRTVKDLSTHDRVVLGVK 282


>gi|16125128|ref|NP_419692.1| hemK family protein [Caulobacter crescentus CB15]
 gi|13422136|gb|AAK22860.1| hemK family protein [Caulobacter crescentus CB15]
          Length = 317

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 146/261 (55%), Gaps = 7/261 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G++  +++ DP   L   Q   L + + R  + E +  I+G + F+ + L
Sbjct: 55  DARLMLEVAAGVTRTEIVTDPYRELSAEQIATLNDYLERRARREPVSHIIGRKGFWKILL 114

Query: 66  TLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            ++ +   PRPETE++VD  L AF      +     +LDLG G+G + LA+L E P  KG
Sbjct: 115 QVNKNVLTPRPETEVIVDEVLKAFP-----EHMAFSMLDLGVGSGTILLAVLAERPAAKG 169

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +G+D S +AL +A+ NA    ++ R   L  DW + +    FD++VSNPPYI + ++D L
Sbjct: 170 LGIDASSEALAVARENAANLDLNTRAALLHGDWTTGLGSDSFDLVVSNPPYIPTEVIDTL 229

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +PR++LDGG DGL+ YR +A  + R L   GL +VEIGY+Q   V  +F +  
Sbjct: 230 EPEVRIHEPRLALDGGPDGLAAYRELAPEILRVLKPGGLFAVEIGYDQSQAVEALFRAAG 289

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              V   KD   +DRV+L  +
Sbjct: 290 ATEVRTVKDLSTHDRVVLGVK 310


>gi|316932076|ref|YP_004107058.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodopseudomonas palustris DX-1]
 gi|315599790|gb|ADU42325.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodopseudomonas palustris DX-1]
          Length = 289

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 140/248 (56%), Gaps = 6/248 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  VTGL    ++V  +  L   +   L     R L  E + RILG R+F+ +  
Sbjct: 29  DARLLVGEVTGLDLTGLLVQAERPLTKDESERLRTFAARRLAGEPVARILGVREFWGLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            LS+DT  PRP+TE +VD+ALA     + +RD    RILD+GTG+GA+ LALL E P   
Sbjct: 89  ELSADTLVPRPDTETVVDAALAV----LGERDAPAPRILDIGTGSGAILLALLSELPGAG 144

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GV  DIS  AL  A+ NA   G++ R   +  D+ S++ G FD+IVSNPPYI    +  L
Sbjct: 145 GVATDISLGALRTARRNAERLGLARRARFVACDYASALSGPFDLIVSNPPYIPVNEIAEL 204

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR+ DPR +LDGG DGL  YR I    +  L  DG   VEIG  Q+ DV  + ++  
Sbjct: 205 DREVREHDPRRALDGGADGLDAYRKIIPESAGLLQPDGALVVEIGQGQETDVSALMQAAG 264

Query: 244 LFLVNAFK 251
           L + + F+
Sbjct: 265 LTVSDPFR 272


>gi|254293183|ref|YP_003059206.1| modification methylase, HemK family [Hirschia baltica ATCC 49814]
 gi|254041714|gb|ACT58509.1| modification methylase, HemK family [Hirschia baltica ATCC 49814]
          Length = 288

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           LRD+   +    G+S+  +I + ++ +  +     +  I R L+ E I RI G R+F+ +
Sbjct: 28  LRDARRLMELAAGMSTTDLIAEENTQIPLQISAKFSAFIQRRLEGEPISRIAGRREFWGL 87

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++SD  +PRP+TE LV+  L+       K D   +LDLGTG+G + L++L E    +
Sbjct: 88  EFVITSDVLDPRPDTETLVELVLSEW-----KSDYKNVLDLGTGSGCILLSILSEKLSAQ 142

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVD 181
           G+G+D S KAL +A  NA    + +R     S+WF ++  E  FDVIVSNPPYI S  ++
Sbjct: 143 GLGLDQSEKALGVATKNAEKLELKQRARFQNSNWFDALTPEQKFDVIVSNPPYIPSADIE 202

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L ++V+ +DP  +LDGG DG   YR I      HLNK+GL + E+G+NQ   V  + E+
Sbjct: 203 VLDIDVKKYDPLSALDGGEDGYDDYRHIISKAKVHLNKNGLIAFEVGFNQAEKVCELLEN 262

Query: 242 RKLFLVNAFKDYGGNDR 258
            K   +N  KD  G  R
Sbjct: 263 EKFIHINVRKDLSGVKR 279


>gi|99080783|ref|YP_612937.1| HemK family modification methylase [Ruegeria sp. TM1040]
 gi|99037063|gb|ABF63675.1| modification methylase HemK family [Ruegeria sp. TM1040]
          Length = 278

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G RDFY  
Sbjct: 26  RDARVLLAHAARIEAARVTLIAPEELSHEVAERYDQLISLRAIRVPVSH-LVGERDFYGR 84

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE L+++ALA    R+        LDLG G+G + + LL E    +
Sbjct: 85  RFKVSGDVLDPRPETETLIEAALAEPFERV--------LDLGVGSGCILVTLLAEQQRAR 136

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVD+S  A   A +NAV + V  R D  QS+WFS+VEG FD+IVSNPPYI    +D L
Sbjct: 137 GLGVDLSEAACLQASANAVLHRVEARADIRQSNWFSAVEGQFDLIVSNPPYIALEEMDGL 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVRD +P+++L  G DGLS YR I  G++ HL  +G   VEIG  Q   V ++     
Sbjct: 197 SAEVRDHEPQMALTDGADGLSAYRQICAGLAPHLAANGRVMVEIGPTQGPAVAQMMRETG 256

Query: 244 LFLVNAFKDYGGNDRVL 260
           L  V+   D  G DRV+
Sbjct: 257 LRDVSVLPDLDGRDRVV 273


>gi|39933684|ref|NP_945960.1| modification methylase HemK family [Rhodopseudomonas palustris
           CGA009]
 gi|39647530|emb|CAE26051.1| putative protoporphyrinogen oxidase, hemK protein [Rhodopseudomonas
           palustris CGA009]
          Length = 289

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 139/246 (56%), Gaps = 2/246 (0%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  V GL    +++  + +L   +   L +   R L  E + RILG R+F+ +  
Sbjct: 29  DARLLVGEVAGLDLTGLLIQAERILTAEENEQLQSLAARRLGGEPVARILGMREFWGLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS+DT  PRP+TE +V++ALA    R       RILD+GTGTGA+ LALL E P   GV
Sbjct: 89  ELSADTLVPRPDTETIVEAALAILAERSSL--APRILDIGTGTGAILLALLHECPDAVGV 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS  AL  A+ NA   G+++R   +  D+ S++ G FD+IVSNPPYI    +  L  
Sbjct: 147 ATDISLGALRTARGNAQRLGLADRACFVACDYASALCGPFDLIVSNPPYIPGNEIAALDR 206

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRD DPR +LDGG DGL  YR I     R L   G+  VEIG  Q+ DV  + ++  L 
Sbjct: 207 EVRDHDPRRALDGGDDGLDAYRKIIPESVRLLQPGGVLVVEIGQGQEGDVSALMQASGLT 266

Query: 246 LVNAFK 251
           + + F+
Sbjct: 267 VSDPFR 272


>gi|89054298|ref|YP_509749.1| HemK family modification methylase [Jannaschia sp. CCS1]
 gi|88863847|gb|ABD54724.1| [protein release factor]-glutamine N5-methyltransferase [Jannaschia
           sp. CCS1]
          Length = 276

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/260 (37%), Positives = 136/260 (52%), Gaps = 9/260 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFL-TNAIVRSLKHESIHRILGWRDF 60
           +A R++   +C    +SS Q+    D        F L   A       + + +I+G  +F
Sbjct: 20  EAEREARLLMCHALKISSAQLYARLDETWPTGPPFQLFVEACEARKSRQPLSQIIGEVEF 79

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           Y  R  ++SD   PRP+TE LVD AL+    R+        LDLGTG+G V   LL E P
Sbjct: 80  YGRRFFVNSDVLTPRPDTETLVDQALSGGFERV--------LDLGTGSGCVLATLLAERP 131

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
              GVG D+S  ALE+A  N    GV +R   + SDWF +V+G FD+I+SNPPYI +  +
Sbjct: 132 GSNGVGTDLSQPALEVAARNVARQGVQDRAVLVHSDWFEAVQGQFDLILSNPPYIAAAEM 191

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             L  EVRD++P ++L  G DGL+ YR I      HL   G   VEIG +Q   V  +F 
Sbjct: 192 RGLAPEVRDWEPHVALTPGGDGLTAYRIITAAGPMHLRAGGRLMVEIGLDQGAAVAELFR 251

Query: 241 SRKLFLVNAFKDYGGNDRVL 260
           +     V   +D  G+DRV+
Sbjct: 252 AAGFGDVRITQDLSGHDRVV 271


>gi|85713813|ref|ZP_01044803.1| modification methylase HemK [Nitrobacter sp. Nb-311A]
 gi|85699717|gb|EAQ37584.1| modification methylase HemK [Nitrobacter sp. Nb-311A]
          Length = 298

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/222 (43%), Positives = 130/222 (58%), Gaps = 1/222 (0%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E + RILG ++F+ + L LSSDT  PR +TE +V++AL         +  +RI D
Sbjct: 70  RRLAGEPLARILGTKEFWGLPLKLSSDTLVPRADTETVVETALDILRAEGRMQAALRIAD 129

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           LGTG+GA+ LALL E P   GVG D+S  AL+ AK+NA   G++ R   L SD+ + + G
Sbjct: 130 LGTGSGAILLALLTELPAATGVGTDLSAAALDTAKTNAQDVGLATRAQFLVSDYGNGLSG 189

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI S  +  L  EVRD DP ++LDGG DGL  YR IA      L   GL 
Sbjct: 190 PFDLIVSNPPYIRSADIATLAPEVRDHDPPLALDGGRDGLDAYRRIAPQALSLLADGGLL 249

Query: 224 SVEIGYNQKVDVVRIFESRKLFLV-NAFKDYGGNDRVLLFCR 264
            +EIG  Q   V R+  +  L ++ +A  D  G  R ++  R
Sbjct: 250 VLEIGQGQDSAVSRLMAAAGLTVMGSARTDLAGIGRAVVARR 291


>gi|167644952|ref|YP_001682615.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Caulobacter sp. K31]
 gi|167347382|gb|ABZ70117.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Caulobacter sp. K31]
          Length = 285

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 146/261 (55%), Gaps = 7/261 (2%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           Q   D+   L     ++   +I DP  VL + Q   L + + R    E +  I+G + F+
Sbjct: 23  QPAIDARLLLEVAADVTRTDIITDPYRVLTETQMATLNDFLERRAAREPVSHIIGRKGFW 82

Query: 62  NVRLTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
            + L ++ +   PRPETE++VD  L AF      ++    +LDLG G+G + LA+L E P
Sbjct: 83  KILLQVNKNVLTPRPETEVIVDEVLKAFP-----EQMSFNMLDLGVGSGTILLAVLAERP 137

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVI 179
             KG+G+D+S  AL +A+ NA +  +S R   L+ DW + + +  FD++VSNPPYI + +
Sbjct: 138 AAKGLGIDVSEDALAVARENAASLDLSGRVALLRGDWTNGLGDNGFDLVVSNPPYIATHV 197

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           ++ L  EVRD +PR++LDGG DGL  YR +A  + R L    + +VEIGY+Q   V  +F
Sbjct: 198 IETLEPEVRDHEPRLALDGGPDGLDAYRLLAGEILRVLKPGAMFAVEIGYDQSAAVEALF 257

Query: 240 ESRKLFLVNAFKDYGGNDRVL 260
                  V   KD   NDRV+
Sbjct: 258 REAGAQNVRTIKDLSVNDRVV 278


>gi|75674574|ref|YP_316995.1| modification methylase HemK [Nitrobacter winogradskyi Nb-255]
 gi|74419444|gb|ABA03643.1| [protein release factor]-glutamine N5-methyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 298

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/222 (41%), Positives = 131/222 (59%), Gaps = 1/222 (0%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E I RILG ++F+ + L LS+DT  PR +TE +V++AL         ++ +RI D
Sbjct: 70  RRLAGEPIARILGTKEFWGLPLKLSADTLVPRADTETVVEAALGVLRAEGRTQEPLRIAD 129

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           LGTG+GA+ LALL E P   GVG D+S  AL+ A++NA   G++ R   L SD+   + G
Sbjct: 130 LGTGSGAILLALLTELPKATGVGTDLSAAALDTARANAQGVGLAARSRFLVSDYADGLSG 189

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI S  +  L  EVRD DP ++LDGG+DGL  YR IA   +  L   GL 
Sbjct: 190 QFDLIVSNPPYIRSADIPTLAPEVRDHDPHLALDGGLDGLDAYRRIAPRAAALLADGGLL 249

Query: 224 SVEIGYNQKVDVVRIFESRKLFLVNAFK-DYGGNDRVLLFCR 264
            +EIG  Q   V  +  +  L ++ + + D  G  R ++  +
Sbjct: 250 VLEIGQGQGGAVTPLVSAAGLTVMGSVRADLAGIGRAVVAGK 291


>gi|328542098|ref|YP_004302207.1| Protein-(glutamine-N5) methyltransferase, release factor-specific
           [polymorphum gilvum SL003B-26A1]
 gi|326411848|gb|ADZ68911.1| Protein-(Glutamine-N5) methyltransferase, release factor-specific
           [Polymorphum gilvum SL003B-26A1]
          Length = 281

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 134/259 (51%), Gaps = 4/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+        GLS   +++  D+ +D  +       +        + RILG R+F+ + L
Sbjct: 25  DARMLTADAAGLSPGDIVLREDAEVDPAREALARAHVAARCGGTPVGRILGRREFWGLEL 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +LS  T EPRP+TE LV++ LA    R        + D+GTG+GA+ +A+L   P    V
Sbjct: 85  SLSPATLEPRPDTETLVEAVLA----RAGGEAAPVLADIGTGSGAIAIAVLTALPEACAV 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS +AL  A++NA+ +GV  R   +Q  + + +   FD IVSNPPYI S  VD L  
Sbjct: 141 ATDISLEALATARANALRHGVDGRMLFVQGSYGAPLGAGFDWIVSNPPYIASAEVDRLAR 200

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DPR +LDGG DGL  YR I       L   G  +VEIG +Q  +V  +      F
Sbjct: 201 EVREHDPRRALDGGADGLDAYRAIVPAARHSLRPGGRLAVEIGADQGAEVAELMAENGFF 260

Query: 246 LVNAFKDYGGNDRVLLFCR 264
            V   +D  G  RV+  CR
Sbjct: 261 DVEIIRDLAGRPRVVSGCR 279


>gi|325578169|ref|ZP_08148304.1| protein methyltransferase HemK [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159905|gb|EGC72034.1| protein methyltransferase HemK [Haemophilus parainfluenzae ATCC
           33392]
          Length = 292

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 153/265 (57%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   ++ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDETEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPFFK 123
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E SP  +
Sbjct: 86  NVSEGTLIPRPDTEILVEKALHIALEKLEENPPHFRILDLGTGTGAIALALASELSPICQ 145

Query: 124 G-------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                   +GVD+  + +++A+SNA  N +  +F  LQS WF +VEG FD+IVSNPPYI+
Sbjct: 146 KKHIQLDVIGVDLMPEVVKLAQSNAEKNQLKVQF--LQSRWFENVEGQFDIIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+PR +L  G +GL+  R + +    HL  +G   +E G+ Q  +V 
Sbjct: 204 EADEHLFQGDVR-FEPRSALVAGENGLADLRHLIEYAPGHLKDNGYLLLEHGWKQGEEVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF       V   +DYG N+RV L
Sbjct: 263 SIFWQNHWQGVATIRDYGDNERVTL 287


>gi|119383646|ref|YP_914702.1| HemK family modification methylase [Paracoccus denitrificans
           PD1222]
 gi|119373413|gb|ABL69006.1| [protein release factor]-glutamine N5-methyltransferase [Paracoccus
           denitrificans PD1222]
          Length = 275

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 133/260 (51%), Gaps = 35/260 (13%)

Query: 26  PDSVLDDRQ---------RFFLTNAIVRSLKHESIHR----------------ILGWRDF 60
           P +  D RQ         R  LT A+   L  E++ R                ILG R F
Sbjct: 20  PGAAEDARQLLAHALELPRHHLTAALAMPLPPEALRRFDASLAARAARQPVSQILGRRAF 79

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           +     ++ DT +PRPETE LV++AL              +LDLGTGTGA+ ++LL E P
Sbjct: 80  WKHEFRVTRDTLDPRPETETLVEAAL--------TEPFASVLDLGTGTGAILISLLAERP 131

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
             +G+G DIS  ALE+A+ NA   GV   F  L+S+WF+SV G FD+IVSNPPYI    +
Sbjct: 132 AARGLGTDISPAALEVARENATRIGVCADF--LESNWFASVAGQFDLIVSNPPYIALEEM 189

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             L  EVR+++PR +L    DGLS YR IA G   HL   G   VEIG  Q   V  +  
Sbjct: 190 AGLSPEVREWEPRAALTDEADGLSAYRAIAAGAPAHLLPGGRLMVEIGPTQGAAVAALMR 249

Query: 241 SRKLFLVNAFKDYGGNDRVL 260
           +  L       D  G DRV+
Sbjct: 250 AVGLAEPRILPDLDGRDRVV 269


>gi|301156076|emb|CBW15547.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Haemophilus parainfluenzae T3T1]
          Length = 292

 Score =  167 bits (424), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   ++ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDETEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLSL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPFFK 123
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E SP  +
Sbjct: 86  NVSEGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELSPICQ 145

Query: 124 G-------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                   +GVD+  + +E+A+SNA  N +  +F  LQS WF  VE  FD+IVSNPPYI+
Sbjct: 146 KKNIQLDVIGVDLMPEVVELAQSNAEKNQLKVQF--LQSRWFEHVEVQFDIIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+PR +L  G +GL+  R + +    HLN  G   +E G+ Q  +V 
Sbjct: 204 ETDEHLFQGDVR-FEPRSALVAGENGLADLRHLIEYAPGHLNDGGYLLLEHGWKQGEEVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF       V   +DYG N+RV L
Sbjct: 263 SIFWQNHWQGVATIRDYGDNERVTL 287


>gi|304394128|ref|ZP_07376051.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ahrensia sp. R2A130]
 gi|303293568|gb|EFL87945.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ahrensia sp. R2A130]
          Length = 283

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 131/257 (50%), Gaps = 5/257 (1%)

Query: 7   SHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLT 66
           + + +  VTG  +  V+V  D   +        N + +      + R +G R+F+ +   
Sbjct: 30  ARAIMAHVTGDDAGMVMVREDVAFNAADAAVFQNLVQKVASGTPLFRAIGVREFHGLDFA 89

Query: 67  LSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVG 126
           LS DT EPR +TE L+++ L+ S P        R  DLGTG+G V ++LL E      V 
Sbjct: 90  LSKDTLEPRDDTEALIEAVLSQSPPAKS-----RFSDLGTGSGIVAISLLHELSEATAVA 144

Query: 127 VDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLE 186
            DIS  AL+ A +NA  NGV ER  T Q  W   +EG FD +VSNPPYI S IVD L   
Sbjct: 145 TDISAGALQTATANAARNGVGERLSTAQGSWCEPLEGAFDFMVSNPPYIASDIVDGLDQS 204

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           V D DPR +LDGG  GL  YR I       L   G  ++EIGY+Q   V  + +      
Sbjct: 205 VLDHDPRRALDGGETGLEAYREILSQAGSLLRPGGFLALEIGYDQAEAVTALAQQTGWRR 264

Query: 247 VNAFKDYGGNDRVLLFC 263
           +  + D  G+DR L+F 
Sbjct: 265 LALYHDLQGHDRALVFA 281


>gi|85705323|ref|ZP_01036422.1| Putative methylase [Roseovarius sp. 217]
 gi|85670196|gb|EAQ25058.1| Putative methylase [Roseovarius sp. 217]
          Length = 285

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/219 (40%), Positives = 122/219 (55%), Gaps = 7/219 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R +    + +ILG R F+     +++D  +PRPETE L+  ALA   P       + +
Sbjct: 61  IARRMARAPVAKILGRRVFWGREFEVTADVLDPRPETECLIAEALAGPKP-------LTL 113

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+G + + LL E P  +GV +D+S +AL++A  NA  +GV +R     SDWF+ +
Sbjct: 114 LDLGTGSGILAVTLLAEWPGVRGVALDLSAEALDVAARNAARHGVRDRLSLCHSDWFAQI 173

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G FD+IVSNPPYI    +  L  EVRD DPR++L    DGL+ YR IA     HLN  G
Sbjct: 174 TGAFDLIVSNPPYIGRDEMVGLMPEVRDHDPRMALTDEGDGLTAYRVIAGAAGAHLNPGG 233

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
              VEIG+ Q   V  +  +     V    D  G DRV+
Sbjct: 234 RLMVEIGWTQGAAVADLLRAAGFEAVAVLPDLEGRDRVV 272


>gi|323142097|ref|ZP_08076945.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Phascolarctobacterium sp. YIT 12067]
 gi|322413484|gb|EFY04355.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Phascolarctobacterium sp. YIT 12067]
          Length = 307

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 142/261 (54%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V      ++  + D  L + +R  + + + R  KHE +  I+G R F     
Sbjct: 30  DAEVLLCAVLKCERIKLYTEFDKPLSEEERDKMRSYVERRAKHEPLAYIIGERAFMRNNF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRPETELLV+S L  + P +     V+ LD+GTG+GA+ ++LL   P   GV
Sbjct: 90  KVTPATLVPRPETELLVES-LVKAAPMLRADGAVKALDIGTGSGAIIVSLLDYLPAAVGV 148

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--VEGLFDVIVSNPPYIESVIVDCL 183
           GVDIS +AL +AK NA   GV +R    QSD FS+  VE  FD+IVSNPPYI +  +  L
Sbjct: 149 GVDISNEALAVAKENAAAIGVDKRVAFRQSDLFSNVPVEKKFDIIVSNPPYIPAADIATL 208

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +V+  +PR +LDGG DGL  YR I    + HL +DGL + EIG +Q   V ++     
Sbjct: 209 AQDVQQ-EPRTALDGGADGLDFYRRICAEAAEHLAEDGLLAFEIGIDQSEAVQKLCLEHG 267

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
                   DY G  R++   +
Sbjct: 268 FAKTAVRMDYAGIPRMIFALK 288


>gi|84686943|ref|ZP_01014827.1| Putative methylase [Maritimibacter alkaliphilus HTCC2654]
 gi|84665140|gb|EAQ11620.1| Putative methylase [Rhodobacterales bacterium HTCC2654]
          Length = 279

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 137/258 (53%), Gaps = 7/258 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L +V  +   ++ ++ D  +         + + R +  E + +I+G R F+ 
Sbjct: 22  AARDAQLLLAQVLRIEVMRLSLERDMQVSPADMLAYEDMLDRRIAREPVSKIIGRRQFWG 81

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
              T++ D  +PRPETE L+  AL  + P        RILDLGTG+G + + LL E    
Sbjct: 82  RDFTVTRDVLDPRPETETLIAEALTGAPPS-------RILDLGTGSGILAITLLAEWREA 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
             V  D+S  AL++A  NA  NGV  R   L SDWF+ V+G FD+IVSNPPYI +  +  
Sbjct: 135 FAVATDLSDPALKVAARNATLNGVDNRLTFLASDWFARVQGRFDLIVSNPPYIAADEMPS 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EV  FDP+++L  G DGL  YR IA G   H++  G   VEIG+ Q   V  IF + 
Sbjct: 195 LAPEVLGFDPQMALTPGGDGLDPYRKIAAGALAHMDPGGRLLVEIGFRQGRAVSDIFAAA 254

Query: 243 KLFLVNAFKDYGGNDRVL 260
            L  V    D  G DRV+
Sbjct: 255 GLDDVRIHPDMDGRDRVI 272


>gi|40062726|gb|AAR37631.1| modification methylase, HemK family [uncultured marine bacterium
           438]
          Length = 280

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 144/259 (55%), Gaps = 4/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L          VI++P  VL+  Q     + I R  K E I  ++  ++F+    
Sbjct: 25  DSEILLSNSIKRDKKHVILNPKEVLNSEQLGKFKSLIERRKKGEPIAYLINKKEFWKDEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ D   PRP++EL+++  L        K D ++ILD+GTG+G + L++LKE   F G 
Sbjct: 85  FVNKDVLIPRPDSELIIEQVLKI----YSKDDQLQILDIGTGSGCILLSILKERSNFYGT 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+DIS K+++++K NA    ++ R     S   +   G +D+IVSNPPYIE + +  L  
Sbjct: 141 GIDISKKSIDVSKFNAKQLNLTNRVKFFHSSVDNFNNGKYDIIVSNPPYIEQLCLKYLEK 200

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           +V +F+P+++L GG DG S  R + +  S  + K+G   +EIG+NQK  V++I +    +
Sbjct: 201 DVVNFEPKLALSGGFDGFSKIRKVINKTSNLIKKNGKFILEIGFNQKNKVIKILKEEGFY 260

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           +  A KDYG NDR ++  +
Sbjct: 261 VNKAIKDYGNNDRCIISTK 279


>gi|254474677|ref|ZP_05088063.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ruegeria sp. R11]
 gi|214028920|gb|EEB69755.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ruegeria sp. R11]
          Length = 285

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 140/257 (54%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  D    +     +R+++    H ++G R+FY  
Sbjct: 28  RDARVLLAHAARIEASRVTLIAPEDLDPDVAERYEQLISLRAIRVPVSH-LVGEREFYGR 86

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +SSD  +PRPETE L+++ALA            R+LDLG G+G + + LL E P   
Sbjct: 87  RFKVSSDVLDPRPETECLIEAALAEPF--------ARVLDLGLGSGCILVTLLAEQPKAT 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVD+S  A   A +NAV + V  R D  QSDWF+ VEG FD+IVSNPPYI    ++ L
Sbjct: 139 GLGVDLSEAACLQASANAVLHRVEPRADVRQSDWFAQVEGQFDLIVSNPPYIALDEMEGL 198

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +P ++L  G DGLS YR I+  V+ +L   G   +EIG  Q   V  +  +  
Sbjct: 199 SAEVRGHEPEMALTDGADGLSAYRAISQQVAEYLAPGGRVLLEIGPTQGAQVAEMLRTAG 258

Query: 244 LFLVNAFKDYGGNDRVL 260
           L  V    D  G DRV+
Sbjct: 259 LVDVRVLPDLDGRDRVV 275


>gi|90422035|ref|YP_530405.1| HemK family modification methylase [Rhodopseudomonas palustris
           BisB18]
 gi|90104049|gb|ABD86086.1| modification methylase, HemK family [Rhodopseudomonas palustris
           BisB18]
          Length = 291

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 133/239 (55%), Gaps = 3/239 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  V GL    ++V    +L   Q   L   + R L  E + RI+G ++F+ + L
Sbjct: 32  DARLLIGAVLGLDLTGLMVGAARLLTPEQASQLDALVTRRLAGEPVARIVGIKEFWGLPL 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L  DT  PRP+TE +V++AL     R   +   RI DLGTG+GA+ LALL E P   GV
Sbjct: 92  ALCGDTLVPRPDTETIVEAALQLFAGRPAPQ---RIADLGTGSGAILLALLSEWPQACGV 148

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS  AL  A++NA   G+ +R   +  D+ S++ G FD+IVSNPPYI S  +  L  
Sbjct: 149 ASDISVAALHTARANAARLGLGDRAAFVACDYASALRGPFDLIVSNPPYIRSADIAALDR 208

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
           EVRD DPR +LDGG DGL+ YRTI    +  L+  G   VEIG  Q  +V  +  +  L
Sbjct: 209 EVRDHDPRRALDGGADGLAAYRTITTQAAGLLSPGGALIVEIGQGQGDEVSALMRAAGL 267


>gi|288956983|ref|YP_003447324.1| HemK protein [Azospirillum sp. B510]
 gi|288909291|dbj|BAI70780.1| HemK protein [Azospirillum sp. B510]
          Length = 282

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 142/253 (56%), Gaps = 3/253 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L     L+    I   +  + D+    +   + R    E + RILG R+F+ + L
Sbjct: 25  DARYLLEHALKLTRTDFITKSEQPVPDQDAAHVLTLVERRAAREPVGRILGHREFWTIDL 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L+ DT EPRP+TE +V++ALA ++P  +++  +R++D GTGTG + LALL E P   GV
Sbjct: 85  VLNPDTLEPRPDTETVVEAALA-AIP--DRKAPLRLIDFGTGTGCILLALLSELPNATGV 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD+S  A++ A  NA  NG+++R      DW   +   FD++VSNPPYI S  +  L  
Sbjct: 142 GVDLSPLAVQAAAGNAERNGLADRARFQIGDWAKDIRDRFDIVVSNPPYIPSADIAALEP 201

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVRD DP  +LDGG DGL  YR +A  + R L   GL + E+G+ Q  DV  + E++ + 
Sbjct: 202 EVRDHDPLRALDGGPDGLEPYRILAAELPRLLLPGGLVAFEVGWGQAEDVAALVEAQGMG 261

Query: 246 LVNAFKDYGGNDR 258
                 D GG  R
Sbjct: 262 ETAILCDLGGVKR 274


>gi|114569198|ref|YP_755878.1| HemK family modification methylase [Maricaulis maris MCS10]
 gi|114339660|gb|ABI64940.1| [protein release factor]-glutamine N5-methyltransferase [Maricaulis
           maris MCS10]
          Length = 319

 Score =  164 bits (416), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 134/222 (60%), Gaps = 6/222 (2%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L    + ++LG + F+ + L +SSD   PR +TE LV++ LA +          R++D
Sbjct: 94  RRLARVPLSQVLGSQPFWTLDLAVSSDVLTPRADTEALVEAVLAEA-----GEASARLVD 148

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-E 162
           LGTG+GA+ LALL E P + G+GVD+S  AL IA +NA   G++ R + +Q  W + + +
Sbjct: 149 LGTGSGAILLALLSERPGWSGLGVDLSAPALAIATANADRCGLANRAEFMQGRWGAGLAD 208

Query: 163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
           G  D++VSNPPYI S I+  L  EVRD +P ++LDGG+DGL  YR I   + R L  +GL
Sbjct: 209 GSVDILVSNPPYIVSDILAGLEPEVRDHEPALALDGGVDGLDAYREIIADLPRLLVSNGL 268

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
            ++EIG++Q V V  +     L  +    D  GNDRV+L  R
Sbjct: 269 FALEIGHDQGVTVSALAREAGLVDIRVLPDLAGNDRVVLGRR 310


>gi|149204049|ref|ZP_01881017.1| Putative methylase [Roseovarius sp. TM1035]
 gi|149142491|gb|EDM30536.1| Putative methylase [Roseovarius sp. TM1035]
          Length = 285

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 135/258 (52%), Gaps = 7/258 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  D+ + L    GL+  ++ +     LD          I R    E + +ILG R F+ 
Sbjct: 22  AAGDARALLAGAVGLARDRLTLHLGEDLDAAALARFEAMIARRAAREPVAKILGRRVFWG 81

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               +++D  +PRPETE L+  ALA   P       + +LDLGTG+G + + LL E P  
Sbjct: 82  REFEVTADVLDPRPETECLIFEALAGPKP-------LTLLDLGTGSGILAVTLLAEWPDA 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
            GV  D+S  AL++A  NA  +GV+ R    +SDWF+ V G+FD+IVSNPPYI +  +  
Sbjct: 135 GGVATDVSDAALDVATRNAARHGVAGRLTLSRSDWFARVAGVFDLIVSNPPYIAAAEMAG 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EVR+ DPR +L    DGL+ YR IA G   HL+  G   VEIG+ Q   V  +  + 
Sbjct: 195 LMPEVREHDPRGALTDEADGLTAYRAIAAGAGAHLSPGGRLMVEIGWKQGPAVADLLCAE 254

Query: 243 KLFLVNAFKDYGGNDRVL 260
               V    D  G DRV+
Sbjct: 255 GFDAVTIRPDLEGRDRVV 272


>gi|259418842|ref|ZP_05742759.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Silicibacter sp. TrichCH4B]
 gi|259345064|gb|EEW56918.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Silicibacter sp. TrichCH4B]
          Length = 278

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 143/258 (55%), Gaps = 10/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G RDFY  
Sbjct: 26  RDARVLLAHAARIEAARVTLIAPEELSHEVAERYDQLISLRAIRVPVSH-LIGERDFYGR 84

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S+D  +PRPETE L+++AL+    R+        LDLG G+G + + LL E     
Sbjct: 85  RFKVSADVLDPRPETETLIEAALSEPFERV--------LDLGVGSGCILVTLLAEQQGAL 136

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVD+S  A   A +NAV + V  R D  QSDWFS+V+G FD+IVSNPPYI    +D L
Sbjct: 137 GLGVDLSEAACLQACANAVLHRVEARADIRQSDWFSAVKGQFDLIVSNPPYIALNEMDDL 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR+ +P+++L  G DGLS YR I  G+  HL + G   VEIG  Q   V  +  +  
Sbjct: 197 SEEVREHEPQMALTDGADGLSAYRLICAGLGCHLAQGGRVLVEIGPTQGAAVAEMMRAAG 256

Query: 244 LFLVNAFKDYGGNDRVLL 261
           L  V    D  G DRV+L
Sbjct: 257 LVEVTVLPDLDGRDRVVL 274


>gi|294678209|ref|YP_003578824.1| protein methyltransferase HemK [Rhodobacter capsulatus SB 1003]
 gi|294477029|gb|ADE86417.1| protein methyltransferase HemK [Rhodobacter capsulatus SB 1003]
          Length = 252

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 127/234 (54%), Gaps = 9/234 (3%)

Query: 31  DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSL 90
           +DR + FL     R  + + + +I G R F+     ++  T +PRPETELLV+ AL  + 
Sbjct: 27  EDRHKQFLKCLAAREAR-QPVAQITGHRAFWKHEFRVTRATLDPRPETELLVEVALETAF 85

Query: 91  PRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERF 150
                    R+LDLGTGTG + L+LL E P  +GV  DIS  AL +A+ NA    + ER 
Sbjct: 86  --------ERVLDLGTGTGCILLSLLAERPAARGVATDISEAALAVAQENAERLSLYERA 137

Query: 151 DTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIA 210
             +Q DWF  VEG FD+IVSNPPYI    +  L  +VRD++P  +L  G DGL  YR IA
Sbjct: 138 HFVQGDWFHGVEGRFDLIVSNPPYITEAEMAELAPDVRDWEPHTALTPGGDGLGAYRAIA 197

Query: 211 DGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
            G    L   G  ++EIG  Q   V  +  ++    V   +D G  DRV+L  R
Sbjct: 198 FGAFARLKPGGRIALEIGPTQAAAVSAMLTAQGFADVEVRQDLGHRDRVVLAHR 251


>gi|300025030|ref|YP_003757641.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526851|gb|ADJ25320.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 295

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 141/258 (54%), Gaps = 2/258 (0%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L  + G+    ++  P+  L D+    + +A+ R L HE + RILG R+FY 
Sbjct: 34  APRDARLLLQGLLGIDGTALLTRPEQPLGDKA-ALIGDAVRRRLAHEPVTRILGVREFYG 92

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               ++ D  +PRP+TE +V+ AL            ++I D+GTG+G +   LL E P  
Sbjct: 93  REFIVTPDVLDPRPDTETVVELALEIVRANGLTSAPLQIADIGTGSGILIATLLLELPNA 152

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +GV  DIS  AL +A+ NA   G+++R   + +       G FD+IVSNPPYI    +  
Sbjct: 153 RGVATDISTAALAVAERNAKRLGLADRTSFVATHSLDGCAGPFDLIVSNPPYIREADIPG 212

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EVRD+DP+++LDGG DGL  YR IA  V+R+  +     +E+G  Q  DV  IF + 
Sbjct: 213 LEPEVRDYDPQLALDGGADGLDVYREIAK-VARNPLRPMRLVLEVGAGQASDVTDIFRAA 271

Query: 243 KLFLVNAFKDYGGNDRVL 260
               +   KD GG+DR +
Sbjct: 272 GWRPLGRQKDLGGHDRAV 289


>gi|254485503|ref|ZP_05098708.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseobacter sp. GAI101]
 gi|214042372|gb|EEB83010.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseobacter sp. GAI101]
          Length = 271

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 141/257 (54%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    F T   +R+++    H ++G R FY  
Sbjct: 18  RDARILLAHAASVDASRVTLIAPEEIAPEIAERFETLIALRAVRVPVSH-LVGQRAFYGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +S D  +PRPETE L++ AL+      E  D V  +DLGTG+G + + LL E P  +
Sbjct: 77  DFKISRDVLDPRPETETLIELALS------EAFDTV--MDLGTGSGCILVTLLAERPEAR 128

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+G+D+S  A   A +NAV +GV+ R D  QSDWF++ EG FD+IV+NPPY+    +  +
Sbjct: 129 GLGLDLSEAACLQASANAVLHGVAARADIRQSDWFAAAEGRFDLIVANPPYLAKSEMAGV 188

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             E+R  +P ++L  G+DGLS YR IA     +L   G    EIG+ Q  DV +IF    
Sbjct: 189 APELRLHEPEMALTDGLDGLSAYRVIASQAQGYLTATGRVLAEIGWQQGPDVAQIFRDAG 248

Query: 244 LFLVNAFKDYGGNDRVL 260
              V    D  G DRVL
Sbjct: 249 WGRVRILPDLDGRDRVL 265


>gi|126739407|ref|ZP_01755100.1| modification methylase, HemK family protein [Roseobacter sp.
           SK209-2-6]
 gi|126719507|gb|EBA16216.1| modification methylase, HemK family protein [Roseobacter sp.
           SK209-2-6]
          Length = 287

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 139/258 (53%), Gaps = 10/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G R+FY  
Sbjct: 34  RDARILLAHAARIEASRVTLIAPEELEPEVAERYEQLISLRAIRVPVSH-LIGEREFYGR 92

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE L+++ALA        +   R+LDLG G+G + + LL E P   
Sbjct: 93  RFKVSGDVLDPRPETECLIEAALA--------QPFERVLDLGLGSGCILVTLLAEQPKAS 144

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G GVD+S  A   A +NAV + V ER D  QSDWFS+V G FD++VSNPPYI    +  L
Sbjct: 145 GFGVDLSEAACLQASANAVLHRVEERIDIQQSDWFSNVTGQFDLVVSNPPYIALPEMQDL 204

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +P ++L  G DGL  YR IA  V  HL   G   +EIG +Q  DV  +     
Sbjct: 205 SPEVRSHEPEMALTDGGDGLGAYRQIAASVREHLLPGGRLLLEIGPSQGRDVTALLAEAG 264

Query: 244 LFLVNAFKDYGGNDRVLL 261
           L  +    D  G DRV++
Sbjct: 265 LLEIRVLPDLDGRDRVVV 282


>gi|90420192|ref|ZP_01228100.1| putative hemK modification methylase involved in heme biosynthesis
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90335526|gb|EAS49276.1| putative hemK modification methylase involved in heme biosynthesis
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 298

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 125/221 (56%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R    E +HRI+G R FY     LS +T EPRP+TE+LV+ A       + ++     
Sbjct: 68  LARRAAGEPVHRIIGRRAFYEHDFVLSPETLEPRPDTEVLVEEAREAMAAIVARKGRCVF 127

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
            D+GTGTGA+ ++LL      + V +DIS  AL  A+ NA+  GV++R   +++++  ++
Sbjct: 128 ADVGTGTGAIAVSLLALFAEAEAVALDISDGALRTARRNAIVAGVADRMLAVRANYLDAI 187

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G  +++VSNPPYI    +  L  EVRD DP ++LDGG DGL  YR +A G  R +   G
Sbjct: 188 GGPLELVVSNPPYIPHDDIAALSREVRDHDPLLALDGGADGLDAYRALATGARRVVRPQG 247

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           L  VEIG  Q+ DV  IF +    L    +D GG  RVL  
Sbjct: 248 LVIVEIGVGQERDVAAIFAAEGFILDAETRDLGGVIRVLTL 288


>gi|86138686|ref|ZP_01057259.1| modification methylase, HemK family protein [Roseobacter sp.
           MED193]
 gi|85824746|gb|EAQ44948.1| modification methylase, HemK family protein [Roseobacter sp.
           MED193]
          Length = 284

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 141/261 (54%), Gaps = 11/261 (4%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H +LG R+FY  
Sbjct: 31  RDARILLAHAARIEASRVTLIAPEDLEPEVAERYEQLIALRAIRVPVSH-LLGEREFYGR 89

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE L+++ALA    R+        LDLG G+G + + LL ESP   
Sbjct: 90  RFKVSKDVLDPRPETETLIEAALAEPFERV--------LDLGLGSGCILVTLLAESPQAT 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVD+S  A   A +NA+ + V  R D  QSDWFS+V G FD+IVSNPPYI    +  L
Sbjct: 142 GLGVDLSEAACLQASANAILHRVESRIDIQQSDWFSNVTGRFDLIVSNPPYIALDEMADL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +P ++L  G DGL+ YR +A GV  HL   G   +EIG  Q   V  + +   
Sbjct: 202 SPEVRQHEPDMALTDGGDGLAAYRALAAGVRAHLRSGGRLCLEIGPTQGQAVAAMMQEAG 261

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
           L  +    D  G DRV +F R
Sbjct: 262 LTNIAVLPDLDGRDRV-VFAR 281


>gi|229844231|ref|ZP_04464372.1| HemK [Haemophilus influenzae 6P18H1]
 gi|229813225|gb|EEP48913.1| HemK [Haemophilus influenzae 6P18H1]
          Length = 292

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 153/265 (57%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALAQSNAERNQLNVQF--LQSRWFDNITGQFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|83953607|ref|ZP_00962328.1| modification methylase, HemK family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841552|gb|EAP80721.1| modification methylase, HemK family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 280

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 139/257 (54%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  D    +     +R+++    H ++G R FY  
Sbjct: 27  RDARILLAHAASVDAARVTLIAPEEIAPDIAERYEKLIALRAVRVPVSH-LVGQRAFYGR 85

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +S D  +PRPETE L++  LA S P        R+LDLGTG+G + + LL E    +
Sbjct: 86  DFKVSRDVLDPRPETESLIE--LALSEP------FERVLDLGTGSGCILVTLLAEQQDAR 137

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVG+D+S  A   A +NAV +GV  R +  QSDWFS+ EG FD+IVSNPPY+    +  +
Sbjct: 138 GVGLDLSEAACLQASANAVLHGVQARAEITQSDWFSAAEGRFDLIVSNPPYLAQSEMADV 197

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             E+R  +P ++L  G DGLS YR IA     +L   G    EIG+ Q  DV  IFE+  
Sbjct: 198 SPELRLHEPEMALTDGQDGLSVYRIIAAQAQGYLAPTGRVLAEIGWQQGADVKAIFEAAG 257

Query: 244 LFLVNAFKDYGGNDRVL 260
              V    D GG DRVL
Sbjct: 258 WGRVRILPDLGGRDRVL 274


>gi|91762345|ref|ZP_01264310.1| HemK [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718147|gb|EAS84797.1| HemK [Candidatus Pelagibacter ubique HTCC1002]
          Length = 280

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 143/259 (55%), Gaps = 4/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L          +I++P  VL+  Q     + I R  K E I  ++  ++F+    
Sbjct: 25  DSEILLSNSIKRDKKHIILNPKEVLNSEQLRKFKSLIERRKKGEPIAYLINKKEFWKDEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ D   PRP++EL+++  L        K D +++LD+GTG+G + L++LKE   F G 
Sbjct: 85  FVNKDVLIPRPDSELIIEQVLKI----YSKDDHLQLLDIGTGSGCILLSILKERSNFYGT 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+DIS K++ ++K NA    ++ R     S   +   G +D++VSNPPYIE + +  L  
Sbjct: 141 GIDISKKSINVSKFNAKQLNLTNRVKFFHSSVDNFNNGKYDIVVSNPPYIEQLSLKYLEK 200

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           +V +F+P+++L GG DG S  R + +  S  + K+G   +EIG+NQK  V++I +    +
Sbjct: 201 DVVNFEPKLALSGGFDGFSKIRKVINKASILIKKNGKFILEIGFNQKNKVIKILKEEGFY 260

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           +  A KDYG NDR ++  +
Sbjct: 261 VNKAIKDYGNNDRCIISTK 279


>gi|83942387|ref|ZP_00954848.1| modification methylase, HemK family protein [Sulfitobacter sp.
           EE-36]
 gi|83846480|gb|EAP84356.1| modification methylase, HemK family protein [Sulfitobacter sp.
           EE-36]
          Length = 280

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 140/257 (54%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  D    +     +R+++    H ++G R FY  
Sbjct: 27  RDARILLAHAASVDAARVTLIAPEEIAPDIAERYEKLIALRAVRVPVSH-LVGQRAFYGR 85

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +S D  +PRPETE L++ AL+    R E     R+LDLGTG+G + + LL E    +
Sbjct: 86  DFKVSRDVLDPRPETESLIELALS---ERFE-----RVLDLGTGSGCILVTLLAEQQDAR 137

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVG+D+S  A   A +NAV +GV  R +  QSDWFS+ EG FD+IVSNPPY+    +  +
Sbjct: 138 GVGLDLSEAACLQASANAVLHGVQARAEIKQSDWFSAAEGRFDLIVSNPPYLAQSEMADV 197

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             E+R  +P ++L  G DGLS YR IA     +L   G    EIG+ Q  DV  IFE+  
Sbjct: 198 SPELRLHEPEMALTDGQDGLSVYRIIAAQAQGYLTPTGRVLAEIGWQQGADVKAIFEAAG 257

Query: 244 LFLVNAFKDYGGNDRVL 260
              V    D GG DRVL
Sbjct: 258 WGRVRILPDLGGRDRVL 274


>gi|148258773|ref|YP_001243358.1| putative methyltransferase hemK [Bradyrhizobium sp. BTAi1]
 gi|146410946|gb|ABQ39452.1| Putative protein methyltransferase hemK modifies release factors
           RF-1 and RF-2 [Bradyrhizobium sp. BTAi1]
          Length = 295

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 132/239 (55%), Gaps = 5/239 (2%)

Query: 8   HSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTL 67
           H+    +TGL  H         L      +L   + R L  E + RILG ++F+ + L L
Sbjct: 39  HALQLDLTGLVMHG-----QRALSAADITWLEALMQRRLAGEPVARILGTKEFWGLELHL 93

Query: 68  SSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGV 127
           S+DT  PRP+TE +V+ AL       + +  +RI DLGTG+GA+ LALL E P   GVG 
Sbjct: 94  SADTLVPRPDTETVVELALEHLAAGGDLKRPLRIADLGTGSGAILLALLSELPAAYGVGT 153

Query: 128 DISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEV 187
           DIS  AL+ A+ NA   G+ +R   +   + S++   FD+IVSNPPYI S  +D L ++V
Sbjct: 154 DISHAALQTARDNARILGLGDRAGFIAGSYASALSPPFDLIVSNPPYIPSREIDDLAIDV 213

Query: 188 RDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           R +DP  +LDGG DGL  YR +    ++ L   G   VE+G  Q  DV  +  + +L +
Sbjct: 214 RAYDPLRALDGGADGLDAYRALIPQAAQLLQPGGTLVVEVGQGQSEDVAELMRAARLAI 272


>gi|71083225|ref|YP_265944.1| hypothetical protein SAR11_0519 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062338|gb|AAZ21341.1| HemK [Candidatus Pelagibacter ubique HTCC1062]
          Length = 280

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 143/259 (55%), Gaps = 4/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L          +I++P  VL+  Q     + I R  K E I  ++  ++F+    
Sbjct: 25  DSEILLSNSIKRDKKYIILNPKEVLNSEQLRKFKSLIERRKKGEPIAYLINKKEFWKDEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ D   PRP++EL+++  L        K D +++LD+GTG+G + L++LKE   F G 
Sbjct: 85  FVNKDVLIPRPDSELIIEQVLKI----YSKDDHLQLLDIGTGSGCILLSILKERSNFYGT 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+DIS K++ ++K NA    ++ R     S   +   G +D++VSNPPYIE + +  L  
Sbjct: 141 GIDISKKSINVSKFNAKQLNLTNRVKFFHSSVDNFNNGKYDIVVSNPPYIEQLSLKYLEK 200

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           +V +F+P+++L GG DG S  R + +  +  + K+G   +EIG+NQK  V++I +    +
Sbjct: 201 DVVNFEPKLALSGGFDGFSKIRKVINKTNNLIKKNGKFILEIGFNQKNKVIKILKEEGFY 260

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           +  A KDYG NDR ++  +
Sbjct: 261 VNKAIKDYGNNDRCVISTK 279


>gi|83951818|ref|ZP_00960550.1| modification methylase, HemK family protein [Roseovarius
           nubinhibens ISM]
 gi|83836824|gb|EAP76121.1| modification methylase, HemK family protein [Roseovarius
           nubinhibens ISM]
          Length = 275

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 121/220 (55%), Gaps = 9/220 (4%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R    E +  ILG R FY     ++ D  +PRPETE LV +AL        +    R+
Sbjct: 61  LARRAAREPMSHILGQRQFYGRAFKVTGDVLDPRPETECLVAAAL--------EEGFERV 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+G + L+LL E    +G+G D+S  AL++A+ NA   G++ R    ++DWF  V
Sbjct: 113 LDLGTGSGCILLSLLAEREGAQGLGADVSAAALDVARENAARLGLASRAAFQEADWFKGV 172

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G +D+IVSNPPYI    +  L  E+   +PR +L    DGLS YR IA GV  HL   G
Sbjct: 173 AGQYDLIVSNPPYIGIAEMPELAPEL-AHEPRAALTDEGDGLSAYRAIAAGVLAHLVPGG 231

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
              VEIG  Q  DV RIF    L  V   +D  G DRV++
Sbjct: 232 RILVEIGRTQGADVARIFAEAGLQAVELRQDLDGRDRVVM 271


>gi|297180645|gb|ADI16855.1| methylase of polypeptide chain release factors [uncultured alpha
           proteobacterium HF0010_13E22]
          Length = 296

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 130/221 (58%), Gaps = 6/221 (2%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E + RI GWR+F+ +RL L+  T +PRP++E +V +ALA + P        R+LD
Sbjct: 68  RRLGGEPVSRIRGWREFWTLRLELAPATLDPRPDSETIVAAALAATDPG----KPCRMLD 123

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--V 161
           LG GTGA+ LA L E P   G GVDI+ +A+E A  NA  NG+S R D +  D+      
Sbjct: 124 LGCGTGALLLACLSERPDATGTGVDIAGEAVEAATRNAGKNGLSARADFVIGDFSDPDVA 183

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G++D+I+ NPPYI +  +D L +EV  FDPR++LDGG DGL  +R +   ++  L++ G
Sbjct: 184 PGIYDLILCNPPYIPAGEIDGLAVEVACFDPRLALDGGDDGLDCWRAVLPRIAAGLSRGG 243

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
              +EIG  Q+  V+ +     L  +   KD+ G  R L+ 
Sbjct: 244 RACLEIGAGQRDAVLGLAARAGLCEIGREKDFAGICRCLVL 284


>gi|260576768|ref|ZP_05844753.1| modification methylase, HemK family [Rhodobacter sp. SW2]
 gi|259021020|gb|EEW24331.1| modification methylase, HemK family [Rhodobacter sp. SW2]
          Length = 284

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 137/259 (52%), Gaps = 10/259 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVD-PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           A RD+   L    GL   ++ +   D +  D       N   RS + + + +I G R F+
Sbjct: 24  AARDARHLLAHAMGLPPDRLTLHLADPLTPDAAALLAANLAARS-QRQPVSQITGNRLFW 82

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
                ++ D  +PRPETE L+ +ALA        +   R+LDLGTG+G + L LL E P 
Sbjct: 83  GRNFRVTQDVLDPRPETESLIAAALA--------QPFQRVLDLGTGSGVLLLTLLAERPA 134

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G+G+D+S  AL +A++NA T  ++ R     SDW ++V G +D++V+NPPYI    + 
Sbjct: 135 ASGLGIDLSPAALNVAQANAETLSLANRATFALSDWLTAVPGQYDLVVANPPYIAEAEMA 194

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++L  G DGL  YR IA GV+ HL   G   VEIG  Q   V  +F +
Sbjct: 195 ALAPEVRLWEPHLALTPGGDGLDAYRAIAAGVAPHLAPGGRLLVEIGPTQAQAVSGLFRA 254

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  +    D  G DRV+
Sbjct: 255 CGLPDIRVLPDLDGRDRVI 273


>gi|260433481|ref|ZP_05787452.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417309|gb|EEX10568.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 281

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 142/257 (55%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H +LG R+FY  
Sbjct: 28  RDARVLLAHAARIEASRVTLIAPEELSPEIAERYEQLVSLRAIRVPVSH-LLGEREFYGR 86

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE L+++AL+        +   R+LDLG G+G + + LL E     
Sbjct: 87  RFRVSRDVLDPRPETEALIEAALS--------QPFDRVLDLGVGSGCILVTLLAERTSAT 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVD+S  A   A +NAVT+GV +R +  +SDWF ++ G FD+IVSNPPYI    +D L
Sbjct: 139 GLGVDLSEAACLQASANAVTHGVQDRAEIQRSDWFENIGGYFDLIVSNPPYIALDEMDGL 198

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR+ +PR++L    DGL  YR IA G   HL   G   VEIG  Q   V  +F++  
Sbjct: 199 SPEVREHEPRLALTDEADGLDAYRRIAAGAPDHLMPGGRILVEIGPTQAKAVSALFDAAG 258

Query: 244 LFLVNAFKDYGGNDRVL 260
           L  +    D  G DRV+
Sbjct: 259 LSDIRIIPDLDGRDRVV 275


>gi|254465042|ref|ZP_05078453.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacterales bacterium Y4I]
 gi|206685950|gb|EDZ46432.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacterales bacterium Y4I]
          Length = 283

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 139/257 (54%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G R+FY  
Sbjct: 26  RDARVLLAHAARIEASRVTLIAPEELAPEVAERYEQLIALRAVRVPVSH-LIGEREFYGR 84

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE+L+++ALA            R+LDLG G+G + + LL E     
Sbjct: 85  RFKVSRDVLDPRPETEILIEAALA--------EPYSRVLDLGVGSGCILVTLLAERQEAT 136

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           G+GVDIS  A   A +NAV + V  R D  QSDWF  VEG FD+IVSNPPYI    ++ L
Sbjct: 137 GLGVDISEAACLQASANAVLHRVQARADIRQSDWFEGVEGQFDLIVSNPPYIALDEMEGL 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +P I+L  G DGL  YR IA  V+ HL   G   +EIG +Q   V  + E   
Sbjct: 197 SAEVRGHEPGIALTDGGDGLGAYRRIAAQVTGHLAPGGRVLLEIGPSQGRAVSALLEEAG 256

Query: 244 LFLVNAFKDYGGNDRVL 260
           L  +   +D  G DRV+
Sbjct: 257 LSGIAVLQDLDGRDRVV 273


>gi|329847925|ref|ZP_08262953.1| protein-glutamine-N5 methyltransferase, release factor-specific
           [Asticcacaulis biprosthecum C19]
 gi|328842988|gb|EGF92557.1| protein-glutamine-N5 methyltransferase, release factor-specific
           [Asticcacaulis biprosthecum C19]
          Length = 284

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 137/260 (52%), Gaps = 5/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   T  +   +I DP   L   Q   L + + R  K E + RILG + F+ + L
Sbjct: 27  DARLLLEAATDATRTDIITDPYRELTAEQEDTLNSYLDRRTKREPVARILGRKGFWKLLL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS     PRPETE++VD  L  S P     D   I DLG G+GA+ L++L E P  KG+
Sbjct: 87  NLSDHVLIPRPETEVIVDMILKQSQPS----DAFTIADLGIGSGAILLSVLAERPAAKGL 142

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLG 184
           G DIS +AL +A+ NA   G+  R   L++ W S + +  FD++ SNPPYI S ++  L 
Sbjct: 143 GTDISEEALAVARDNAANLGLDGRAAFLRTSWGSGLADASFDIVASNPPYIRSDVIPTLD 202

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV++ DP ++LDGG  GL+ Y  +A  + R L   G   +EIG++Q  DV ++      
Sbjct: 203 PEVKNHDPHLALDGGPTGLAAYEELAPEIFRLLKPGGRAWLEIGFDQSQDVEKLMNDAGF 262

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
             V  + D     RV+   +
Sbjct: 263 LNVATWLDLSNLPRVVTATK 282


>gi|297181090|gb|ADI17289.1| methylase of polypeptide chain release factors [uncultured alpha
           proteobacterium HF0070_17D04]
          Length = 296

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 140/259 (54%), Gaps = 6/259 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L    GL    +  +  +  DD         + R L  E + RI GWR+F+ +RL
Sbjct: 30  DSRLLLGTALGLDRAVLPHETLAGFDDTAAAMFEAFLNRRLGGEPVSRIRGWREFWTLRL 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L+  T +PRP++E +V +ALA + PR       R+LDLG GTGA+ LA L E P   G 
Sbjct: 90  ELTPATLDPRPDSETIVAAALAATDPR----KPCRMLDLGCGTGALLLACLSERPDATGT 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--VEGLFDVIVSNPPYIESVIVDCL 183
           GVDI+ +A+E A  NA  NG+S R D +  D+       G++D+I+ NPPYI +  +D L
Sbjct: 146 GVDIAGEAVEAATRNAGKNGLSARADFVIGDFSDPDVAPGIYDLILCNPPYIPAGEIDGL 205

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
            +EV  FDP ++LDGG DGL  +R +   ++  L++ G   +EIG  Q+  V+ +     
Sbjct: 206 AVEVACFDPHLALDGGDDGLDCWRAVLPRIAASLSRGGRACLEIGAGQEDAVLGLAAKVG 265

Query: 244 LFLVNAFKDYGGNDRVLLF 262
           L  +   KD  G  R L+ 
Sbjct: 266 LCEIGREKDLAGICRCLVL 284


>gi|145642041|ref|ZP_01797612.1| HemK [Haemophilus influenzae R3021]
 gi|145273221|gb|EDK13096.1| HemK [Haemophilus influenzae 22.4-21]
          Length = 292

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHVTGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E  P   
Sbjct: 86  NVSKGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELEPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEF--LQSRWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF      +V   +DYG N+RV L
Sbjct: 263 SIFLENYWEMVETVRDYGDNERVTL 287


>gi|16273459|ref|NP_439708.1| hypothetical protein HI1559 [Haemophilus influenzae Rd KW20]
 gi|260580340|ref|ZP_05848169.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Haemophilus influenzae RdAW]
 gi|1170230|sp|P45253|HEMK_HAEIN RecName: Full=Protein methyltransferase hemK homolog; AltName:
           Full=M.HindHemKP
 gi|1574403|gb|AAC23208.1| hemK protein (hemK) [Haemophilus influenzae Rd KW20]
 gi|260093017|gb|EEW76951.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Haemophilus influenzae RdAW]
          Length = 292

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMSDVVALAQSNAERNQLNVEF--LQSRWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DY  N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYSDNERVTL 287


>gi|299132854|ref|ZP_07026049.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Afipia sp. 1NLS2]
 gi|298592991|gb|EFI53191.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Afipia sp. 1NLS2]
          Length = 292

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 131/233 (56%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V  L    +I      L+  +   L + + R +  E I RILG ++F+ +  
Sbjct: 30  DARLLLGDVLQLDLTGLIAAAARTLNANETAALESRVQRRIDGEPIARILGHKEFWGLSF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           TLS  T  PRP+TE +V++AL          D + I D+GTG+GA+ LALL E P  +G+
Sbjct: 90  TLSPATLVPRPDTETIVEAALDILKQDGRLNDALHISDIGTGSGAILLALLSELPNAQGI 149

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G DI+  A+  A  NA   G++ R   ++ ++  ++ G FD+IVSNPPYI S  +D L +
Sbjct: 150 GTDINPDAIHTATRNAAALGLNGRARFIECNYADALRGPFDLIVSNPPYIPSRDIDDLAI 209

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
           EVR  DPR++LDGG DGL  YR IA      L   G+  +EIG  Q+ DV R+
Sbjct: 210 EVRAHDPRLALDGGPDGLDAYRVIAPAAFELLVPGGVVILEIGQGQERDVARL 262


>gi|56697311|ref|YP_167677.1| HemK family modification methylase [Ruegeria pomeroyi DSS-3]
 gi|56679048|gb|AAV95714.1| modification methylase, HemK family [Ruegeria pomeroyi DSS-3]
          Length = 271

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 119/210 (56%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  ++G RDFY  R  +S +  +PRPETE L+++AL              +LDLG G+GA
Sbjct: 64  VSHLVGERDFYGRRFKVSGEVLDPRPETETLIEAAL--------NAPFEHVLDLGVGSGA 115

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + + LL E P   G+GVD+S  A   A +NAV + V  R D  +SDWF +VEG FD+IVS
Sbjct: 116 ILVTLLAERPSATGLGVDLSEAACLQASANAVLHRVEARADIRRSDWFGAVEGRFDLIVS 175

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI    ++ L  EVR  +P ++L  G DGL  YR IA G   +L   G   VEIG  
Sbjct: 176 NPPYIALSEMEALAPEVRRHEPELALTDGGDGLGAYRHIAAGAPDYLLPGGRLLVEIGPT 235

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V R+F++  L  +    D  G DRV+
Sbjct: 236 QAQAVSRLFQAAGLSGLRVIPDLDGRDRVV 265


>gi|301170296|emb|CBW29902.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Haemophilus influenzae 10810]
          Length = 292

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG    Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKLRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPFFK 123
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P  +
Sbjct: 86  NVSKSTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 124 G-------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                   +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI 
Sbjct: 146 KRHIPLEIIGVDLMSDVVALAQSNAERNQLNVQF--LQSCWFDNITGKFDLIVSNPPYIN 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|209883258|ref|YP_002287115.1| protein-(glutamine-N5) methyltransferase [Oligotropha
           carboxidovorans OM5]
 gi|209871454|gb|ACI91250.1| protein-(glutamine-N5) methyltransferase [Oligotropha
           carboxidovorans OM5]
          Length = 290

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/232 (40%), Positives = 131/232 (56%), Gaps = 1/232 (0%)

Query: 30  LDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           LD  +   L + I R +  E + RILG R+F+ +   LS  T  PRP+TE L+++ L   
Sbjct: 54  LDTSEAQRLEDVIRRRIAGEPVARILGRREFWGLTFALSPATLVPRPDTETLIEAVLDIL 113

Query: 90  LPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER 149
                    +RILD+GTG+GA+ LALL E P   G+G DI+  A+  A  NA T G++ R
Sbjct: 114 KREGRTAAPLRILDIGTGSGAILLALLSELPNTTGIGTDINPAAIATAADNAATLGLASR 173

Query: 150 FDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTI 209
              +  D+  ++ G FD++VSNPPYI +  +D L LEVR  DPR++LDGG DGL+ YRTI
Sbjct: 174 ATFVACDYAGALRGPFDIVVSNPPYIPTADIDHLDLEVRAHDPRLALDGGADGLTAYRTI 233

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFK-DYGGNDRVL 260
           A      L   G+ +VEIG  Q   V  +     L +    K D GG  RV+
Sbjct: 234 APLAFALLAPSGIAAVEIGQRQAHGVATLMAEAGLAVPAPAKADLGGVPRVV 285


>gi|118588513|ref|ZP_01545922.1| protoporphyrinogen oxidase [Stappia aggregata IAM 12614]
 gi|118439219|gb|EAV45851.1| protoporphyrinogen oxidase [Stappia aggregata IAM 12614]
          Length = 282

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 129/219 (58%), Gaps = 6/219 (2%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           + L+   + RILG R+FY  R  L+  T EPRP+TE L+D+ L     R    +   + D
Sbjct: 63  KRLEGMPVGRILGEREFYGRRFLLNPATLEPRPDTETLIDAVLE----RCTADEAPVMCD 118

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-- 161
           +GTGTGA+ + LL E P  + + VD+S +ALE A SNA  +GV +R  T+++D+ S++  
Sbjct: 119 IGTGTGAIAVTLLAELPRSRMIAVDLSEQALECAASNAALHGVGDRLLTVRADYTSALRP 178

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
           EG FD +VSNPPYI + ++  L  EV   DP+++LDGG DGL+ Y  I     + L   G
Sbjct: 179 EGGFDWVVSNPPYIRTAVLAELSREVIQHDPKLALDGGEDGLTAYVRILTDAEKLLRPGG 238

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
             ++EIG++Q  D+ +         +   KD  GNDRV+
Sbjct: 239 RIALEIGFDQGADLKKQLRHHGFVEIEIIKDLSGNDRVV 277


>gi|148826081|ref|YP_001290834.1| hypothetical protein CGSHiEE_05375 [Haemophilus influenzae PittEE]
 gi|229847125|ref|ZP_04467230.1| HemK [Haemophilus influenzae 7P49H1]
 gi|148716241|gb|ABQ98451.1| HemK [Haemophilus influenzae PittEE]
 gi|229809954|gb|EEP45675.1| HemK [Haemophilus influenzae 7P49H1]
 gi|309973232|gb|ADO96433.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Haemophilus influenzae R2846]
          Length = 292

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHVTGKSRTQILTFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALARSNAERNQLNVQF--LQSSWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 VQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF      +V   +DYG N+RV L
Sbjct: 263 SIFLENYWEMVETVRDYGDNERVTL 287


>gi|84516321|ref|ZP_01003681.1| modification methylase, HemK family [Loktanella vestfoldensis
           SKA53]
 gi|84510017|gb|EAQ06474.1| modification methylase, HemK family [Loktanella vestfoldensis
           SKA53]
          Length = 277

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 118/208 (56%), Gaps = 8/208 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  +LG+RDFY+ R  ++ D  +PRP+TE +V +ALA             +LDLGTG+G 
Sbjct: 67  LSHLLGYRDFYDHRFIVTPDVLDPRPDTEAIVTAALADPF--------AHVLDLGTGSGC 118

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + L+LL   P   G+GVD+S  AL +A  N    G+ +R   ++SDWF++V G FD+IVS
Sbjct: 119 ILLSLLAARPQATGLGVDLSDAALAVAAQNRSALGLDQRATLVRSDWFTAVTGSFDLIVS 178

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI +  +  L  EVR  +P ++L  G DGLS+YR IA G   HL   G   VEIG  
Sbjct: 179 NPPYIAATEMAGLQPEVRLHEPHLALTDGADGLSYYRIIAAGAGAHLAPGGRLIVEIGPT 238

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           Q  DV  +  +     +    D  G DR
Sbjct: 239 QASDVSALLRAAGFTDLRVIPDLDGRDR 266


>gi|145632950|ref|ZP_01788683.1| HemK [Haemophilus influenzae 3655]
 gi|144986606|gb|EDJ93172.1| HemK [Haemophilus influenzae 3655]
          Length = 292

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG    Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKLRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALAQSNAERNQLNVQF--LQSRWFDNITGQFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|296447418|ref|ZP_06889343.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylosinus trichosporium OB3b]
 gi|296255038|gb|EFH02140.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylosinus trichosporium OB3b]
          Length = 304

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 134/251 (53%), Gaps = 2/251 (0%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+ + L     +++  ++++P + L    +  L +   R    E + RILG R F+   
Sbjct: 33  RDARALLLAAGEMTAADLLLEPHARLSPCVQRRLDDFARRRAAREPVTRILGARGFWTQD 92

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ D  +PR +TE LV  ALA  L R  + D + ILDLG G+GA+  ALL E P  + 
Sbjct: 93  LVVAPDVLDPRADTETLV--ALALDLLRERRNDALTILDLGVGSGAITCALLSELPQARA 150

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           VGVD+S +A   A  N    G++ R   L+  W  ++E  FD++VSNPPY+ S  +  L 
Sbjct: 151 VGVDLSGEACAAASVNIARCGIAARATILRGRWAQALETRFDLVVSNPPYVASGEIATLA 210

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVR  DP ++LDGG DGL+ YR I   + R L    L  +E G  Q   +  + E+  L
Sbjct: 211 PEVRLHDPSLALDGGADGLACYREIIADLPRILAPHALAVLEAGAGQAASIAALLEAAGL 270

Query: 245 FLVNAFKDYGG 255
            +    +D+ G
Sbjct: 271 EIAEIREDFAG 281


>gi|257464823|ref|ZP_05629194.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor 202]
 gi|257450483|gb|EEV24526.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor 202]
          Length = 289

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 146/257 (56%), Gaps = 6/257 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    ++VL + +   L   + R  K E I  ILG ++F+++ L
Sbjct: 29  DANVLLQAVTKRSKSAIFAFSETVLSEAELTELNALLARRAKGEPIAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S+ T  PRP+TE LV+ AL ++  R+  ++ ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  AVSTATLIPRPDTECLVEVALEWAYKRLNSQETLQILDLGTGTGAIALALASELGEKAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
           +GVD   +A+++A+ N    G  + RF  LQSDWFS +E   FD+IVSNPPYI+    + 
Sbjct: 149 IGVDKQAEAVQLAEQNRQNLGFEQVRF--LQSDWFSVLENHCFDLIVSNPPYIDKDDENL 206

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L     GLS  + I +    +L K G   +E G+ Q  DV +IF+  
Sbjct: 207 TKGDVR-FEPLTALVAEQHGLSDLQKIIENAPLYLAKQGALMLEHGWQQAADVQQIFKQN 265

Query: 243 KLFLVNAFKDYGGNDRV 259
           +   +  FKDYG  DR+
Sbjct: 266 QWDKIETFKDYGNQDRI 282


>gi|148826785|ref|YP_001291538.1| hypothetical protein CGSHiGG_00160 [Haemophilus influenzae PittGG]
 gi|148718027|gb|ABQ99154.1| HemK [Haemophilus influenzae PittGG]
          Length = 292

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 150/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEF--LQSRWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF      +V   +DYG N+RV L
Sbjct: 263 SIFLENYWEMVETVRDYGDNERVTL 287


>gi|84503528|ref|ZP_01001579.1| modification methylase, HemK family protein [Oceanicola batsensis
           HTCC2597]
 gi|84388018|gb|EAQ01066.1| modification methylase, HemK family protein [Oceanicola batsensis
           HTCC2597]
          Length = 279

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 122/223 (54%), Gaps = 8/223 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R L HE + RI+G R FY     +S  T +PRPETE LV  AL        +R   R+
Sbjct: 63  IARRLLHEPVSRIVGGRWFYGRWFDVSPATLDPRPETETLVQIAL--------ERRFDRV 114

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTGTG + ++LL E    +GVG D+S  AL  A  NA T GV++R   ++SDW + V
Sbjct: 115 LDLGTGTGCIVISLLAERADARGVGSDLSEGALATAAENAATCGVADRLSLVRSDWMAGV 174

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
           +G FD+IVSNPPYI    +  L  +V  FDPR +L  G+DGL  YR IA      L   G
Sbjct: 175 DGTFDLIVSNPPYIAPEEMSGLAPDVTKFDPRQALTDGVDGLGAYRAIAAQAPARLVPGG 234

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
              VEIG  Q   V  +F    L  +  F D  G DRV+   R
Sbjct: 235 RLLVEIGPTQAGAVAGLFRDAGLTEIRTFPDLDGRDRVVAALR 277


>gi|110680313|ref|YP_683320.1| HemK family modification methylase [Roseobacter denitrificans OCh
           114]
 gi|109456429|gb|ABG32634.1| modification methylase, HemK family, putative [Roseobacter
           denitrificans OCh 114]
          Length = 271

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 125/210 (59%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           + +++G R+FY  R  ++ +  +PRPETE L++ AL+     +        LDLG G+G 
Sbjct: 64  VSQLIGGREFYGRRFEITREVLDPRPETESLIEVALSAPFNTV--------LDLGVGSGC 115

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + + LL E P   GV VD+S  A   A +NAV + V++R   L+SDWF +VEG FD+IVS
Sbjct: 116 LIVTLLAERPDATGVAVDLSEAACLQASANAVLHEVADRVQVLKSDWFDAVEGRFDLIVS 175

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPY+ +  +  +  E+RD +PR++L    DGL+ YR IA     +L+ DG   VE G+ 
Sbjct: 176 NPPYLAASEMAQVQPELRDHEPRLALTDEADGLTAYRVIAAEAQGYLSADGRVLVETGWR 235

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q  DV  IFE++    ++   D GG DR++
Sbjct: 236 QASDVRDIFEAQGWGELSILPDLGGRDRIV 265


>gi|163735802|ref|ZP_02143231.1| modification methylase, HemK family, putative [Roseobacter
           litoralis Och 149]
 gi|161390888|gb|EDQ15228.1| modification methylase, HemK family, putative [Roseobacter
           litoralis Och 149]
          Length = 277

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 127/210 (60%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           + +++G R+FY  R  ++ +  +PRPETE L+++AL  S P  +       LDLG G+G 
Sbjct: 70  VSQLIGSREFYGRRFNITREVLDPRPETESLIEAAL--SAPFSDA------LDLGVGSGC 121

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + + LL E P  KGV +DIS  A   A +NAV + V++R   L+SDWF +VEG FD+IVS
Sbjct: 122 LIVTLLAERPDAKGVAIDISEAACLQASANAVLHEVADRVQVLKSDWFDAVEGRFDLIVS 181

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPY+ +  +  +  E+RD +PR++L    DGL+ YR IA     +L+ +G   VE G+ 
Sbjct: 182 NPPYLAASEMSQVQPELRDHEPRLALTDEADGLTAYRVIAAEAQGYLSAEGRVLVETGWQ 241

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V  IFE++    ++   D GG DR++
Sbjct: 242 QASSVRDIFEAQGWGELSILPDLGGRDRIV 271


>gi|126725347|ref|ZP_01741189.1| Putative methylase [Rhodobacterales bacterium HTCC2150]
 gi|126704551|gb|EBA03642.1| Putative methylase [Rhodobacterales bacterium HTCC2150]
          Length = 277

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/211 (40%), Positives = 122/211 (57%), Gaps = 8/211 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           + +I+G R FY     ++ D  +PRPETE+L+ +AL        ++   ++LDLGTG+GA
Sbjct: 70  VSQIIGRRHFYGRDFIVTPDVLDPRPETEILISAAL--------EQPFQKVLDLGTGSGA 121

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + + LL E     G G DIS  AL +A  NAV   VSER D ++SDWF +V+G FD+IVS
Sbjct: 122 ILVTLLAEQMGANGQGADISDAALNVASRNAVALNVSERADFVKSDWFENVDGDFDLIVS 181

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPY+ +     L   VR+F+P+++L  G DGL  YR I + +   L   G   VEIG  
Sbjct: 182 NPPYVTADEYSALDKGVREFEPKLALTPGGDGLMPYRLITERIQSFLRPFGRLLVEIGPT 241

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           Q   V  +F+   L  V   KD+   DRV++
Sbjct: 242 QGAAVKAMFKESGLSEVQVLKDFDARDRVVI 272


>gi|284047801|ref|YP_003398140.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acidaminococcus fermentans DSM 20731]
 gi|283952022|gb|ADB46825.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acidaminococcus fermentans DSM 20731]
          Length = 302

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 140/261 (53%), Gaps = 7/261 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V   S  Q+  + D  L++++       + R    E +  ILG + F     
Sbjct: 32  DAEVLLCAVLDKSRIQLYTNFDEPLEEQELKQYRGYVARRAAREPVAYILGHKGFLQYDF 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ DT  PRPETELLV+  ++ +      R  VRILDLG G+GA+  +LL E P  +G+
Sbjct: 92  KVTKDTLIPRPETELLVEQLVSLN----RDRGPVRILDLGCGSGAIIDSLLAELPEARGM 147

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCL 183
           GVDIS  A  + + NA + GV +R +T+ SD +  V  E  F V+VSNPPYI    +  L
Sbjct: 148 GVDISPGAAAVTRENAQSLGVGDRLETVVSDLYEKVPREEKFQVLVSNPPYIPEGDLAGL 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV   +PR +LDGG DGL  YR I   +  +L+ +G+ + EIG  Q  DV R+     
Sbjct: 208 QAEVHR-EPRRALDGGRDGLDFYRRILRDLWSYLDPEGMAAFEIGQGQGEDVARLCREAG 266

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
           L  V   KDYG  DR++   +
Sbjct: 267 LDCVKVRKDYGDMDRMVFAAK 287


>gi|307256017|ref|ZP_07537805.1| Protein hemK [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306865439|gb|EFM97334.1| Protein hemK [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 296

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 147/256 (57%), Gaps = 4/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG ++F+++ L
Sbjct: 29  DTNLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL ++  R++ +  +RILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPHTLIPRPDTECLVEVALDWAYKRLKIQQTLRILDLGTGTGAIALALASELGNNVQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+++A++N    G S     LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 149 LGVDFKAEAVQLAETNRQNLGFS-NVSFLQSDWFSALENQQFDLIVSNPPYIDQQDENLQ 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    DGLS  + I      HLN +G   +E G+ Q   V +IF+  +
Sbjct: 208 YGDVR-FEPLSALVAEQDGLSDLQKIIQNAPLHLNDNGALILEHGWQQAQAVQQIFQQYQ 266

Query: 244 LFLVNAFKDYGGNDRV 259
              + +F+DYGGNDR+
Sbjct: 267 WDEIASFQDYGGNDRL 282


>gi|312115444|ref|YP_004013040.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220573|gb|ADP71941.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 306

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 133/264 (50%), Gaps = 8/264 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIV---RSLKHESIHRILGWRDFYN 62
           D+        G SS +++   D+ L       L  AI    R    E + RI+G R+F+ 
Sbjct: 26  DARLLSAYAAGFSSEEIVTKRDTALPPE---ILDRAIAVAQRRFAGEPVSRIVGTREFWG 82

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +   LS  T +PRP+TE+LVD+ LA+          +RILDLGTGTG +  ALL E P  
Sbjct: 83  MPFGLSPHTLDPRPDTEVLVDAGLAWCRKHDLANAPLRILDLGTGTGCILAALLSELPKA 142

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW-FSSVEGLFDVIVSNPPYIESVIVD 181
            GVGVD S  AL  A++N    G+S R      DW  +  +  FD+I  NPPYIE+  + 
Sbjct: 143 TGVGVDRSEGALRTARANFARLGLSSRAFFFCGDWGVALADATFDIIACNPPYIETADIA 202

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV-RIFE 240
            L  EVRDFDP ++LDGG DGL  YR I    SR L   GL   E G+ Q   V   + E
Sbjct: 203 GLCAEVRDFDPALALDGGKDGLKAYRDIVPQASRLLRVPGLLIFETGHRQARSVRDMVTE 262

Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264
               F    F D  G +R +   R
Sbjct: 263 LDAGFQTEIFLDLAGIERAVAGVR 286


>gi|319897177|ref|YP_004135372.1| n5-glutamine methyltransferase, modifies release factors rf-1 and
           rf-2 [Haemophilus influenzae F3031]
 gi|317432681|emb|CBY81044.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Haemophilus influenzae F3031]
          Length = 292

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 149/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  L   + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLIALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESP---- 120
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E      
Sbjct: 86  NVSKSTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELSSICQ 145

Query: 121 ----FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRLISLEIIGVDLMPDVVALAQSNAERNQLNVEF--LQSCWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|260583302|ref|ZP_05851077.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Haemophilus influenzae NT127]
 gi|260093662|gb|EEW77575.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Haemophilus influenzae NT127]
          Length = 292

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 151/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG    Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKLRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E +P   
Sbjct: 86  NVSKSTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMSDVVALAQSNAERNQLNVQF--LQSCWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L    +G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANGEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF      +V   +DYG N+RV L
Sbjct: 263 SIFLENYWEMVETVRDYGDNERVTL 287


>gi|332140930|ref|YP_004426668.1| peptide release factor-glutamine N5-methyltransferase(HemK)
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550952|gb|AEA97670.1| peptide release factor-glutamine N5-methyltransferase(HemK)
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 285

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 141/262 (53%), Gaps = 9/262 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  + G S   +   PD  L   Q     +AI R    E +  I+G RDF+ + L
Sbjct: 23  DAKVMLADILGKSQTYLFTWPDKTLTPSQIAEFEDAIERRKAGEPVAYIIGKRDFWTLSL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIE----KRDVVRILDLGTGTGAVCLALLKESPF 121
             SS T  PRP+TE+LV+  + ++   +      +  + I DLGTGTGA+ LAL  E P 
Sbjct: 83  FTSSHTLIPRPDTEVLVEHVINWATGNVSANTPNKPPLSICDLGTGTGAIALALASELPQ 142

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVI 179
              +GVD    A+ +AK NA +N ++  RF  +QSDWFS++ G  FD+IVSNPPYI+   
Sbjct: 143 ASVIGVDFLSDAVALAKRNANSNKINNARF--MQSDWFSALRGHTFDIIVSNPPYIDETS 200

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
                 +VR F+P+ +L  G  GLS  + I    S +LN +GL + E G++Q   V  + 
Sbjct: 201 PYLNEGDVR-FEPKSALTSGDSGLSDIKHIISHASTYLNSNGLLAFEHGFDQGDAVKALL 259

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
           ++     V   KDYG NDRV L
Sbjct: 260 QTSGFVNVKTIKDYGNNDRVTL 281


>gi|315500227|ref|YP_004089030.1| protein-(glutamine-n5) methyltransferase, release factor-specific
           [Asticcacaulis excentricus CB 48]
 gi|315418239|gb|ADU14879.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Asticcacaulis excentricus CB 48]
          Length = 289

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 135/257 (52%), Gaps = 5/257 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG +   ++ DP  +L   Q+  L + + R  K   + RILG + F+ + L
Sbjct: 30  DARLLLEAATGYTRTDILTDPYKLLTAEQKATLDDYLTRREKRVPVARILGRKGFWKLLL 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L+     PRPETE +VD  L  +    E+     + DLG G+GA+ L++L E P  KG+
Sbjct: 90  DLTPAVLVPRPETECIVDMILKTT----EEGQAFTLADLGVGSGAILLSVLSERPAAKGL 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLG 184
           G D+S +AL +A+ NA   G+  R   L++ W + + +  FD + SNPPYI S ++  L 
Sbjct: 146 GTDVSEEALAVARDNAANLGLDGRAAFLRTSWGAGLADASFDFVASNPPYIRSEVIPTLD 205

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVRD DP ++LDGG  GL  Y  +     R L   G   +EIGY+Q   V  + +    
Sbjct: 206 PEVRDHDPHLALDGGESGLDAYIEMIPEAFRILKAGGTAWMEIGYDQSAAVEDLMKKAGF 265

Query: 245 FLVNAFKDYGGNDRVLL 261
           F V  FKD     R+++
Sbjct: 266 FNVVTFKDLSDLPRIVI 282


>gi|68249926|ref|YP_249038.1| hypothetical protein NTHI1574 [Haemophilus influenzae 86-028NP]
 gi|145631801|ref|ZP_01787561.1| HemK [Haemophilus influenzae R3021]
 gi|68058125|gb|AAX88378.1| HemK [Haemophilus influenzae 86-028NP]
 gi|144982591|gb|EDJ90141.1| HemK [Haemophilus influenzae R3021]
          Length = 292

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 148/265 (55%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF-- 121
            +S  T  PRP+TE LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E  P   
Sbjct: 86  NVSKSTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELEPICQ 145

Query: 122 -----FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEF--LQSRWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L     G +  R I +  S +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDVR-FEPLSALVANDAGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DY  N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYSDNERVTL 287


>gi|86747199|ref|YP_483695.1| HemK family modification methylase [Rhodopseudomonas palustris
           HaA2]
 gi|86570227|gb|ABD04784.1| modification methylase, HemK family [Rhodopseudomonas palustris
           HaA2]
          Length = 289

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 142/251 (56%), Gaps = 3/251 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   TGL    +IV  + VL   +   L    VR L  E + RILG R+F+ + L
Sbjct: 29  DARLLIGEATGLDLTGLIVQAERVLTLDEAERLDAFAVRRLAGEPVARILGVREFWGLAL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS DT  PRP+TE +V++AL     R E R    ILDLGTG+GA+ LALL E P   GV
Sbjct: 89  RLSDDTLVPRPDTETVVEAALDHL--RAEARARPLILDLGTGSGAILLALLSECPDAFGV 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             DIS  AL  A++NA   G+++R   +  D+ +++ G FD+IVSNPPYI +  +  L +
Sbjct: 147 ATDISLGALRAARANAAALGLADRAGFVACDYAAALGGSFDLIVSNPPYIPASAIAALDV 206

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR+ DPR +LDGG DGL  YR I    +R L + G   VEIG  Q  DV  +  +  L 
Sbjct: 207 EVREHDPRRALDGGEDGLDAYRRIIPEAARLLGRGGALVVEIGQGQGDDVAALMRASGLA 266

Query: 246 LVN-AFKDYGG 255
           +     +D GG
Sbjct: 267 VPEPPRRDLGG 277


>gi|83859677|ref|ZP_00953197.1| hemK family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852036|gb|EAP89890.1| hemK family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 285

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 3/259 (1%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L      S  +++ +  S + D +       I R  + E +  ILG + F+
Sbjct: 24  EAADDARRLLLAAFEGSPARLLTEMASEMPDAELERFDALIGRREQREPLSHILGTQPFW 83

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
            + L ++ D   PR +TE L+++ALA + P  ++R  +RILD+ TG+GA+ LALL E P 
Sbjct: 84  TLELKVTRDVLTPRADTETLIEAALA-AYP--DRRAPLRILDIATGSGAIILALLSEFPN 140

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G   DIS  AL +A+ NA   G+++R       W   +EG FD++VSNPPYI + ++D
Sbjct: 141 ATGAATDISEAALAVAQENADLTGLADRVSFQHQSWADGLEGPFDLLVSNPPYIATAVID 200

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++PR++L+GG  G   Y  +    SR L   GL   EIGY+Q V        
Sbjct: 201 ELEPEVRAYEPRMALEGGRTGFEPYPHLFAEASRLLVPGGLALFEIGYDQGVRAREAASE 260

Query: 242 RKLFLVNAFKDYGGNDRVL 260
                    KD  G+DRV+
Sbjct: 261 AGAKETRILKDLAGHDRVV 279


>gi|254559641|ref|YP_003066736.1| protein-( glutamine-N5) methyltransferase [Methylobacterium
           extorquens DM4]
 gi|254266919|emb|CAX22718.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium extorquens DM4]
          Length = 302

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 135/226 (59%), Gaps = 6/226 (2%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L  A  R L  E + RILG  +F+ +   L  +T  PRP+TE +V++AL   LP  E+  
Sbjct: 71  LRQAAERRLAGEPVARILGAWEFWGLSFALGPETLVPRPDTESVVETALRL-LP--ERER 127

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
            +R++DLGTG+G + +ALL E P   G+G+D S  AL IA+ NA  NGV++R   L   W
Sbjct: 128 PLRLIDLGTGSGCILVALLHERPGALGIGLDRSAAALAIARRNAAANGVADRAAFLCGSW 187

Query: 158 FSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH- 216
            +++EG FD+IVSNPPYI + ++  L  EVR  DP+ +LDGG DGL  YR I   V+R  
Sbjct: 188 LNALEGPFDLIVSNPPYIAAPVIATLEPEVRLHDPQAALDGGADGLDAYRAILADVARRP 247

Query: 217 --LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
             L+  G   +EIGY+Q   + R+ +      +   +D  GNDRV+
Sbjct: 248 GLLSAQGALVLEIGYDQANALTRLAQEAGFEDIGVGQDLAGNDRVV 293


>gi|240137463|ref|YP_002961934.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium extorquens AM1]
 gi|240007431|gb|ACS38657.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium extorquens AM1]
          Length = 302

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 134/226 (59%), Gaps = 6/226 (2%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L  A  R L  E + RILG  +F+ +   L  +T  PRP+TE +V++AL   LP  E+  
Sbjct: 71  LRQAAERRLAGEPVARILGAWEFWGLPFALGPETLVPRPDTESVVETALRL-LP--ERER 127

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
            +R++DLGTGTG + +ALL E P   G+G+D S  AL IA+ NA  NGV++R   L   W
Sbjct: 128 PLRLIDLGTGTGCILVALLHERPGAVGIGLDRSAAALAIARRNAAANGVADRAAFLCGSW 187

Query: 158 FSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH- 216
             ++EG FD+IVSNPPYI + ++  L  EVR  DP+ +LDGG DGL  YR I   V+R  
Sbjct: 188 LDALEGPFDLIVSNPPYIAAPVIATLEPEVRLHDPQAALDGGADGLDAYRAILADVARRP 247

Query: 217 --LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
             L+  G   +EIGY+Q   + R+ +      +   +D  GNDRV+
Sbjct: 248 GLLSAQGALVLEIGYDQANALTRLAQEAGFEDIGFGRDLAGNDRVV 293


>gi|54288339|gb|AAV31627.1| putative protoporphyrinogen oxidase [uncultured alpha
           proteobacterium EBAC2C11]
          Length = 294

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 143/237 (60%), Gaps = 2/237 (0%)

Query: 28  SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA 87
           S LD   +  L+  + R L  E I RI GWR+F+++R  +S  T +PRP++E ++ +A+ 
Sbjct: 54  SPLDAGCQRHLSAMLERRLAGEPISRIRGWREFWSLRFAISQSTLDPRPDSETMIQAAVT 113

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
           +++    + D +R LDLGTG+G + L+LL E P   G+G+D+S  A+ +A +NA + G+ 
Sbjct: 114 WAIANSAQMDPLRCLDLGTGSGCLLLSLLSELPQAIGIGIDVSLDAIGVAVANANSLGLG 173

Query: 148 ERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSH 205
           +R    Q  +   +   G FD+I+SNPPYI ++ +  L ++VR+FDP ++LDGG DG+S 
Sbjct: 174 DRVHFHQHSFCDDLSNFGSFDIILSNPPYIPTLDIAGLAVDVREFDPALALDGGFDGMSC 233

Query: 206 YRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           +R +   +   L+ +G   VEIG  Q+  +V++  +  L LV + +D     R L F
Sbjct: 234 WRGLLPRLGELLSDEGAAFVEIGKGQEAAIVQLASNANLELVKSHRDLSDVIRCLQF 290


>gi|163746456|ref|ZP_02153814.1| modification methylase, HemK family, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380341|gb|EDQ04752.1| modification methylase, HemK family, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 280

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 131/239 (54%), Gaps = 9/239 (3%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
            ++ P+ +  D    F     +R+++   + +++G R FY    ++S D  +PRPETE L
Sbjct: 45  TLIAPEEIAPDVAERFEQLIALRAVRV-PVSQLIGRRAFYGRDFSISRDVLDPRPETETL 103

Query: 82  VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNA 141
           VD AL     RI        LDLGTG+G + + LL E     G+GVD+S  A   A +NA
Sbjct: 104 VDLALGSHFDRI--------LDLGTGSGCILVTLLAERAQATGLGVDLSEAACLQASANA 155

Query: 142 VTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGID 201
           V +GV+ER +  QSDWFS+VEG FD+I+SNPPY+ +  +  +  E+R  +P ++L  G D
Sbjct: 156 VQHGVAERAEIRQSDWFSAVEGRFDLILSNPPYLAAEEMADVSPELRQHEPEMALTDGQD 215

Query: 202 GLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           GLS YR IA     +L  +G   VEIG+ Q   V  IF       V    D  G  RV+
Sbjct: 216 GLSIYRIIATEAQGYLTPEGRVMVEIGWQQGEAVQDIFTKAGWGRVTLAHDLDGRPRVV 274


>gi|239996063|ref|ZP_04716587.1| peptide release factor-glutamine N5-methyltransferase(HemK)
           [Alteromonas macleodii ATCC 27126]
          Length = 279

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 133/257 (51%), Gaps = 5/257 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  + G S   +   P+  LD  Q+      + +  + E +  I+G RDF+ + L
Sbjct: 23  DAKVMLANILGKSQTYLFTWPNKTLDAAQKAQFEADVAKRKRGEPVAYIIGKRDFWTLSL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
             S DT  PRP+TE+LV+  L ++         + I DLGTGTGA+ LAL  E P     
Sbjct: 83  FTSPDTLIPRPDTEVLVEHVLNWA--NQHSSASLSICDLGTGTGAIALALASELPEASVT 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLG 184
           GVD    A+ +A  NA  N ++     +QSDWFS++ G  FD+IVSNPPYIE        
Sbjct: 141 GVDFQAGAVNLATRNAQANSIANAH-FVQSDWFSALAGQTFDIIVSNPPYIEESSPYLNE 199

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L  G DGL   + I +   ++LNK  L + E G++Q   V  +      
Sbjct: 200 GDVR-FEPKTALTSGSDGLDDIKQIINNAPQYLNKGALLAFEHGFDQGAAVNALLVDAGF 258

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   KDYG NDRV L
Sbjct: 259 VEVKTVKDYGDNDRVTL 275


>gi|165977489|ref|YP_001653082.1| protein-glutamine N-methyl transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165877590|gb|ABY70638.1| protein-glutamine N-methyl transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 320

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 145/256 (56%), Gaps = 4/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG ++F+++ L
Sbjct: 53  DANLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKEFWSLPL 112

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL +   R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 113 KVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDKAQI 172

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  E    LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 173 IGVDFKLEAVTLAETNRQNLGF-ENVRFLQSDWFSALENRQFDLIVSNPPYIDQQDENLQ 231

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    DGLS  + I      HLN +G   +E G+ Q   V +IF+  +
Sbjct: 232 YGDVR-FEPLSALVAEQDGLSDLQKIIQNAPLHLNDNGALILEHGWQQAQAVQQIFQQYQ 290

Query: 244 LFLVNAFKDYGGNDRV 259
              + +F+DYGGNDR+
Sbjct: 291 WDEIASFQDYGGNDRL 306


>gi|254472106|ref|ZP_05085506.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pseudovibrio sp. JE062]
 gi|211958389|gb|EEA93589.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pseudovibrio sp. JE062]
          Length = 294

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 133/256 (51%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+        G+    ++++ D  +       +T      L  + + RILG R+F+ +  
Sbjct: 35  DARVLTAEALGIEPRNLVLEYDREISPEVIAVMTRYAEERLAGKPVGRILGKREFWGLEF 94

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +LS  T EPRP+TE LV++ LAF              D+GTGTGA+ +ALL E P    V
Sbjct: 95  SLSQATLEPRPDTETLVEATLAFCQANGGFDKPWVFADIGTGTGAIAIALLSELPNAICV 154

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
            VDIS +ALE A+ NA  NG   RF  ++  +  ++ G FD +VSNPPYI S +++ L  
Sbjct: 155 AVDISEEALETARQNAANNGFESRFIPVRGSYLDALNGAFDFVVSNPPYIRSAVIEGLSH 214

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV+  DP ++LDGG DGL+ Y+ +       L ++    +EIG++Q  ++  +       
Sbjct: 215 EVKQHDPMLALDGGDDGLTAYKELIGNAKLVLKRNSGLLMEIGFDQAEELSTLARELVGL 274

Query: 246 LVNAFKDYGGNDRVLL 261
            V    D  G  RV++
Sbjct: 275 EVRCEHDLAGQPRVIV 290


>gi|145639101|ref|ZP_01794709.1| HemK [Haemophilus influenzae PittII]
 gi|145272073|gb|EDK11982.1| HemK [Haemophilus influenzae PittII]
 gi|309751052|gb|ADO81036.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Haemophilus influenzae R2866]
          Length = 292

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 146/265 (55%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG    Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQYATGKPRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE------ 118
            +S  T  PRP+TE+LV+ AL  SL ++E+     RILDLGTGTGA+ LAL  E      
Sbjct: 86  NVSKGTLIPRPDTEVLVEKALQISLEKLEQNPPHFRILDLGTGTGAIALALASELFSICQ 145

Query: 119 --SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KRQISLEIIGVDLMPDVVALAQSNAERNQLNVQF--LQSRWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+P  +L     G +  R I +    +LN +G   +E G+ Q   V 
Sbjct: 204 VQDEHLHQGDVR-FEPLSALVANDAGYADLRYIIESAPNYLNFNGTLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|323138797|ref|ZP_08073861.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylocystis sp. ATCC 49242]
 gi|322395945|gb|EFX98482.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylocystis sp. ATCC 49242]
          Length = 298

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 139/244 (56%), Gaps = 2/244 (0%)

Query: 21  QVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETEL 80
           ++ + P + L +     L++   R    E + RILG R F+ + L ++ D  +PRP+TE 
Sbjct: 52  ELAMRPQAPLAEEHADALSHYAARRAAREPVSRILGERGFWTLDLLVAPDVLDPRPDTET 111

Query: 81  LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN 140
           L+++ L   L   ++ + + ILDLGTG+GA+  ALL E P  + V VD+S +A   A +N
Sbjct: 112 LIETTL--DLIGEKRNEPLSILDLGTGSGAIVCALLSELPRARAVAVDLSPQACAAAANN 169

Query: 141 AVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGI 200
               G S R   ++  W +++   FD+IVSNPPY+ +  +  L  EVR  DP ++LDGGI
Sbjct: 170 LARCGFSNRASVMRGRWAAALSERFDIIVSNPPYVRAGEIPQLDPEVRLHDPALALDGGI 229

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           DGL  YR I D + R +  DGL + E+G +Q V V  +  ++   +    +D GG++RV+
Sbjct: 230 DGLDCYREIIDDLPRLVADDGLVAFEVGSDQAVSVASLLGAQGFGVERVGRDLGGHERVV 289

Query: 261 LFCR 264
              R
Sbjct: 290 AARR 293


>gi|163743156|ref|ZP_02150538.1| modification methylase, HemK family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161383573|gb|EDQ07960.1| modification methylase, HemK family protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 285

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 140/259 (54%), Gaps = 14/259 (5%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G R+FY  
Sbjct: 28  RDARVLLAHAARIEASRVTLIAPEDLAPEIAERYEQLIALRAIRVPVSH-LIGEREFYGR 86

Query: 64  RLTLSSDTFEPRPETELLVDSALA--FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
           R  +S D  +PRPETE L+++ALA  FS          R+LDLG G+G + + LL E   
Sbjct: 87  RFKVSGDVLDPRPETECLIEAALAEPFS----------RVLDLGLGSGCILVTLLAEQAD 136

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             GVGVD+S  A   A +NAV + V  R + LQSDWFS+VEG FD+IVSNPPYI    + 
Sbjct: 137 ATGVGVDLSEAACLQASANAVLHRVEPRAEILQSDWFSAVEGQFDLIVSNPPYIALDEMS 196

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR  +P ++L  G DGL  YR IA  +  +L   G   +EIG  Q   V  +  S
Sbjct: 197 DLSDEVRGHEPELALTDGGDGLGAYRVIAAELGGYLAPQGRVFLEIGPTQGAAVSDLLLS 256

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V   +D  G DRV+
Sbjct: 257 AGLKEVRIIQDLDGRDRVV 275


>gi|163739712|ref|ZP_02147120.1| modification methylase, HemK family protein [Phaeobacter
           gallaeciensis BS107]
 gi|161386942|gb|EDQ11303.1| modification methylase, HemK family protein [Phaeobacter
           gallaeciensis BS107]
          Length = 285

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 140/259 (54%), Gaps = 14/259 (5%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  +    +     +R+++    H ++G R+FY  
Sbjct: 28  RDARVLLAHAARIEASRVTLIAPEDLAPEIAERYEQLIALRAIRVPVSH-LIGEREFYGR 86

Query: 64  RLTLSSDTFEPRPETELLVDSALA--FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
           R  +S D  +PRPETE L+++ALA  FS          R+LDLG G+G + + LL E   
Sbjct: 87  RFKVSGDVLDPRPETECLIEAALAEPFS----------RVLDLGLGSGCILVTLLAEQAD 136

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             GVGVD+S  A   A +NAV + V  R + LQSDWFS+V+G FD+IVSNPPYI    + 
Sbjct: 137 ATGVGVDLSEAACLQASANAVLHRVEPRAEVLQSDWFSAVDGQFDLIVSNPPYIALDEMS 196

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR  +P ++L  G DGL  YR IA  +  +L   G   +EIG  Q   V  +  S
Sbjct: 197 GLSDEVRGHEPEMALTDGGDGLGAYRVIAAELGGYLAPQGRVFLEIGPTQGAAVSDLLLS 256

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V   +D  G DRV+
Sbjct: 257 AGLKEVRVIQDLDGRDRVV 275


>gi|255264803|ref|ZP_05344145.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thalassiobium sp. R2A62]
 gi|255107138|gb|EET49812.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thalassiobium sp. R2A62]
          Length = 277

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 132/252 (52%), Gaps = 14/252 (5%)

Query: 17  LSSHQVIVDPDSVL----DD---RQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
           L++H + V PD +     DD    Q+  L   I R   HE + +++G R F+     ++ 
Sbjct: 29  LAAHVLQVSPDRMTLHMGDDVTAGQKAQLHVLIARRAAHEPVSKLIGQRAFWGRDFAVTP 88

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D  +PRPETE L+++ L             R+LDLGTG+GA+ + L  E         D+
Sbjct: 89  DVLDPRPETECLIEACLGAG-------PAARVLDLGTGSGAIAVTLAAEWDAAAVTATDL 141

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRD 189
           S  AL++A+ NAV + V  R + + SDWF +V+G +D+IVSNPPYI    +  L  EVR 
Sbjct: 142 SHAALDVARQNAVRHDVGARIEFVGSDWFDAVDGCYDLIVSNPPYIALAEMTGLAPEVRG 201

Query: 190 FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNA 249
            DPR++L    DGL+ YR I DG    +   G  +VEIG  Q   V  + +   L  +  
Sbjct: 202 HDPRMALTDEADGLTCYRIICDGALAKMVSGGRLAVEIGPTQGDAVALMMQEAGLVEIEI 261

Query: 250 FKDYGGNDRVLL 261
             D  G +RV+L
Sbjct: 262 RPDLDGRNRVVL 273


>gi|145629733|ref|ZP_01785529.1| HemK [Haemophilus influenzae 22.1-21]
 gi|144978070|gb|EDJ87849.1| HemK [Haemophilus influenzae 22.1-21]
          Length = 264

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 144/261 (55%), Gaps = 12/261 (4%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L   TG    Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L +S 
Sbjct: 2   LLQYATGKPRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSK 61

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE--------SP 120
            T  PRP+TE+LV+ AL  SL ++E+     RILDLGTGTGA+ LAL  E          
Sbjct: 62  GTLIPRPDTEVLVEKALQISLEKLEQNPPHFRILDLGTGTGAIALALASELFSICQKRQI 121

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
             + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI+    
Sbjct: 122 SLEIIGVDLMPDVVALAQSNAERNQLNVQF--LQSRWFDNITGKFDLIVSNPPYIDVQDE 179

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P  +L     G +  R I +    +LN +G   +E G+ Q   V  IF+
Sbjct: 180 HLHQGDVR-FEPLSALVANDAGYADLRYIIESAPNYLNFNGTLLLEHGWQQGEKVRSIFQ 238

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                +V   +DYG N+RV L
Sbjct: 239 ENHWEMVETVRDYGDNERVTL 259


>gi|240950072|ref|ZP_04754374.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor NM305]
 gi|240295447|gb|EER46202.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor NM305]
          Length = 289

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    ++VL + +   L   + R  K E I  ILG ++F+++ L
Sbjct: 29  DANILLQAVTKRSKSAIFAFSETVLSEAELIELNALLARRAKGEPIAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S+ T  PRP+TE LV+ AL ++  R+  ++ ++ILDLGTGTGA+ LAL  E       
Sbjct: 89  AVSTATLIPRPDTECLVEVALEWAYKRLNSQETLQILDLGTGTGAIALALASELGKKADI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
           +G+D   +A+E+A+ N    G    RF  LQSDWFS +E   FD+IVSNPPYI+    + 
Sbjct: 149 IGLDKQSEAVELAEKNRQKLGFKNVRF--LQSDWFSVLENHCFDLIVSNPPYIDKDDENL 206

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L     GLS  + I +    +L K G   +E G+ Q  +V +IF   
Sbjct: 207 TKGDVR-FEPLTALVAEQHGLSDLQKIIENAPLYLAKQGALMLEHGWQQAAEVQQIFRQN 265

Query: 243 KLFLVNAFKDYGGNDRV 259
           +   +  FKDYG  DR+
Sbjct: 266 QWDKIETFKDYGNQDRI 282


>gi|163850387|ref|YP_001638430.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium extorquens PA1]
 gi|163661992|gb|ABY29359.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium extorquens PA1]
          Length = 296

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 133/224 (59%), Gaps = 6/224 (2%)

Query: 40  NAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV 99
            A  R L  E + RILG  +F+ +   L  +T  PRP+TE +V++AL   LP  E+   +
Sbjct: 67  QAAERRLAGEPVARILGAWEFWGLPFALGPETLVPRPDTESVVETALRL-LP--EREQPL 123

Query: 100 RILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS 159
           R++DLGTG+G + +ALL E P   G+G+D S  AL +A+ NA  NGV++R   L   W  
Sbjct: 124 RLIDLGTGSGCILVALLHERPGALGIGLDRSAAALAVARRNAAANGVADRAAFLCGSWLD 183

Query: 160 SVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH--- 216
           +++G FD+IVSNPPYI + ++  L  EVR  DP+ +LDGG DGL  YR I   V+R    
Sbjct: 184 ALKGPFDLIVSNPPYIAAPVIATLEPEVRLHDPQAALDGGADGLDAYRAILADVARRPGL 243

Query: 217 LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           L+  G   +EIGY+Q   + R+ +      +   +D  GNDRV+
Sbjct: 244 LSAQGALVLEIGYDQANALTRLAQEAGFEDIGVGRDLAGNDRVV 287


>gi|117926779|ref|YP_867396.1| HemK family modification methylase [Magnetococcus sp. MC-1]
 gi|117610535|gb|ABK45990.1| [protein release factor]-glutamine N5-methyltransferase
           [Magnetococcus sp. MC-1]
          Length = 289

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 139/263 (52%), Gaps = 8/263 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVL--DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D    L     L    + +DPD  L  D+ QR+     I R    E +  I+G + F + 
Sbjct: 31  DGELLLAHTLTLRRLDLFLDPDRPLSPDELQRY--KAFIKRRAAREPVAYIVGKKPFLHW 88

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            LT+++    PRPETE LV +A  F     ++R    ILD+GTG+GA+ LALL      +
Sbjct: 89  ELTVTAGVLIPRPETEHLVQAAQDFF--NQQQRAPHTILDIGTGSGAILLALLDHFNEAQ 146

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVD 181
           G+G+DIS  AL  A+ N     ++ R   L S +   +  E  FD+I+SNPPYI S ++ 
Sbjct: 147 GIGIDISKAALACAQHNGEQLNLNNRAQWLYSHFCDDLPHESRFDLILSNPPYINSDVIP 206

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EV  ++PR++LDGG+DG+  Y+ I       LN  GL  VEIG++Q   V  + + 
Sbjct: 207 TLEAEVNQWEPRLALDGGVDGMQAYQQIIPAAVARLNPGGLLGVEIGHDQGPRVAALMQQ 266

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
             L  V   KDY  +DRV+L  R
Sbjct: 267 HGLQQVVVHKDYAQHDRVVLGHR 289


>gi|254510882|ref|ZP_05122949.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacteraceae bacterium KLH11]
 gi|221534593|gb|EEE37581.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacteraceae bacterium KLH11]
          Length = 285

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 137/257 (53%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           RD+   L     + + +V ++ P+ +  D    +     +R+++    H +LG R+FY  
Sbjct: 28  RDARVLLAHAARIEASRVTLIAPEELPVDIAERYDQLISLRAIRVPVSH-LLGEREFYGR 86

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  +S D  +PRPETE L+++AL+      E  D   +LDLG G+G + + LL E     
Sbjct: 87  RFKVSRDVLDPRPETEALIEAALS------EPFD--HVLDLGVGSGCILITLLAERASAA 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVGVD+S  A   A +NAV + V  R +  QSDWF ++EG FD+IVSNPPYI +  +  L
Sbjct: 139 GVGVDLSESACLQASANAVQHQVQGRVEIRQSDWFENIEGQFDLIVSNPPYISADEMQEL 198

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR+ +PRI+L    DGL  YR IA      L   G   VEIG  Q   V  +F++  
Sbjct: 199 SPEVREHEPRIALTDEGDGLDAYRRIAAAAPDFLTPGGRILVEIGPTQGAYVSALFDAAG 258

Query: 244 LFLVNAFKDYGGNDRVL 260
           L       D  G DRV+
Sbjct: 259 LTGTQVIPDLDGRDRVV 275


>gi|157804238|ref|YP_001492787.1| tRNA (guanine-N(7)-)-methyltransferase [Rickettsia canadensis str.
           McKiel]
 gi|157785501|gb|ABV74002.1| tRNA (guanine-N(7)-)-methyltransferase [Rickettsia canadensis str.
           McKiel]
          Length = 323

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 145/277 (52%), Gaps = 25/277 (9%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V       +++  D  L+  +       + R LKHE I  I+G ++FY+    ++ 
Sbjct: 31  LLQHVINTPLQYLLIKLDEQLNQSEIEAFEKLLERRLKHEPIAYIIGVKEFYSREFIVNK 90

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDV-----------------------VRILDLGT 106
               PR +TELLVD  +A  + R   R+                        ++IL+LGT
Sbjct: 91  HVLIPRGDTELLVDIVVAL-VKRCHYRESRNPVNHYMDTCLRGYDTRLQTNNIKILELGT 149

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-F 165
           G+G + ++LL E P    +  DIS  A+E+A++NA+ + V++    + S+WF ++E   F
Sbjct: 150 GSGCIAISLLCELPNANVIATDISLDAIEVARNNALKHHVTDHIQIIHSNWFENIENQKF 209

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D IVSNPPYI +     + +E  +++P ++L    +GL  Y+TIA+   + L ++G  ++
Sbjct: 210 DFIVSNPPYISNTEKSEMAIETINYEPHLALFAEENGLQSYKTIAENAKKFLKQNGKLAL 269

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           EIG+ QK  V++IF  +   L N +KD  G  RV+LF
Sbjct: 270 EIGFKQKETVIQIFLDQGYNLENVYKDLQGYSRVILF 306


>gi|218528947|ref|YP_002419763.1| modification methylase, HemK family [Methylobacterium
           chloromethanicum CM4]
 gi|218521250|gb|ACK81835.1| modification methylase, HemK family [Methylobacterium
           chloromethanicum CM4]
          Length = 296

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 93/224 (41%), Positives = 133/224 (59%), Gaps = 6/224 (2%)

Query: 40  NAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV 99
            A  R L  E + RILG  +F+ +   L  +T  PRP+TE +V++AL   LP  E+   +
Sbjct: 67  QAAERRLAGEPVARILGAWEFWGLPFALGPETLVPRPDTESVVETALRL-LP--ERERPL 123

Query: 100 RILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS 159
           R++DLGTG+G + +ALL E P   G+G+D S  AL +A+ NA  NGV++R   L   W  
Sbjct: 124 RLIDLGTGSGCILVALLHERPGALGIGLDRSAAALAVARRNAAANGVADRAAFLCGSWLD 183

Query: 160 SVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH--- 216
           ++EG FD+IVSNPPYI + ++  L  EVR  DP+ +LDGG DGL  YR I   V+R    
Sbjct: 184 ALEGPFDLIVSNPPYIAAPVIATLEPEVRLHDPQAALDGGADGLDAYRAILADVARRPGL 243

Query: 217 LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           L+  G   +EIGY+Q   + R+ +      +   +D  GNDRV+
Sbjct: 244 LSVQGALVLEIGYDQANALTRLAQEAGFEDIAVGRDLAGNDRVV 287


>gi|319776410|ref|YP_004138898.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Haemophilus influenzae F3047]
 gi|329123574|ref|ZP_08252136.1| protein methyltransferase HemK [Haemophilus aegyptius ATCC 11116]
 gi|317451001|emb|CBY87231.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Haemophilus influenzae F3047]
 gi|327470316|gb|EGF15776.1| protein methyltransferase HemK [Haemophilus aegyptius ATCC 11116]
          Length = 292

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 149/265 (56%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L
Sbjct: 26  DALVLLQHATGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPFFK 123
            +S  T  PRP+TE+LV+ AL  +L ++E+      ILDLGTGTGA+ LAL  E +P  +
Sbjct: 86  NVSKSTLIPRPDTEILVEKALQIALEKLEENPPHFCILDLGTGTGAIALALASELAPICQ 145

Query: 124 G-------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                   +GVD+    + +A+SN   N ++ +F  LQS WF ++ G FD+IVSNPPYI+
Sbjct: 146 KQHIPLEIIGVDLMPDVVALAQSNTERNQLNVQF--LQSCWFDNITGKFDLIVSNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +V  F+P  +L    +G +  R I +    +LN +G+  +E G+ Q   V 
Sbjct: 204 AQDEHLHQGDV-SFEPLSALVANDEGYADLRHIIELAPSYLNSNGVLLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF+     +V   +DYG N+RV L
Sbjct: 263 SIFQENHWEMVETVRDYGDNERVTL 287


>gi|83310718|ref|YP_420982.1| methylase of polypeptide chain release factor [Magnetospirillum
           magneticum AMB-1]
 gi|82945559|dbj|BAE50423.1| Methylase of polypeptide chain release factor [Magnetospirillum
           magneticum AMB-1]
          Length = 283

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 137/259 (52%), Gaps = 3/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  V G+   ++     + L   +   L   + R    E +  ILG R F+ +  
Sbjct: 26  DARLLVAEVLGVEMRRLPASHHAELTGDEAARLAALLERRAAREPMSHILGRRGFWTLEF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +++DT +PRP+TE L+++ L     R   R   R+LD GTGTG + L LL E     G+
Sbjct: 86  AVTADTLDPRPDTETLIEAVLDALEDRGRPR---RLLDFGTGTGCILLTLLSELGHATGL 142

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+D S  AL +A  NA++ G++ R +    DW   + G FDVIVSNPPYI    +D L  
Sbjct: 143 GIDASPAALAVAGRNALSLGLAPRAEFRLGDWGEGLNGQFDVIVSNPPYIPDAEIDGLEP 202

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV  ++PR +L GG DGL  YR +   ++R L   G+ ++E+G  Q VDV  +  +  L 
Sbjct: 203 EVARYEPRSALAGGSDGLECYRRLIPHMARLLAPGGIAALEVGAGQAVDVCALLAAAGLA 262

Query: 246 LVNAFKDYGGNDRVLLFCR 264
             +  +D GG +R ++  R
Sbjct: 263 GASVRRDLGGIERCVIVRR 281


>gi|297181250|gb|ADI17444.1| methylase of polypeptide chain release factors [uncultured
           Rhodospirillales bacterium HF0070_31K06]
          Length = 211

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 120/211 (56%), Gaps = 3/211 (1%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  I G R+F ++R  +++D  +PRP++E+L+++ALA  LP     +   +LDLGTGTG 
Sbjct: 1   MSHITGSREFRSLRFEVTADVLDPRPDSEVLIEAALAL-LP--ATGEPFNVLDLGTGTGC 57

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + LA+L E P   G+GVD+S  AL +A+ NA   G++ER    + DW + + G FD+++S
Sbjct: 58  LLLAVLNERPAATGIGVDLSEAALAVARRNAWKLGLAERAQFRRGDWSNGLGGTFDLVLS 117

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S  +D L  EV   +PR++LDGG DGL  YR IA    + L   G   VE G  
Sbjct: 118 NPPYIPSAEIDQLEPEVACHEPRLALDGGADGLDAYRAIAQRTPQLLANKGALIVEFGTG 177

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           Q   V  IF    L       D  G  R  +
Sbjct: 178 QAEAVCAIFAQHGLAEARLECDLAGRPRCFI 208


>gi|159044281|ref|YP_001533075.1| putative protein methyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157912041|gb|ABV93474.1| putative protein methyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 274

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 127/225 (56%), Gaps = 8/225 (3%)

Query: 36  FFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEK 95
           + L +A+      + + +I+G R F+     ++ D  +PRP+TE LV+ ALA        
Sbjct: 53  YTLEDAVKARAARQPVSQIIGRRAFFKHDFEVTPDVLDPRPDTETLVEVALAHPF----- 107

Query: 96  RDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQS 155
            D V  LD+G+G+G + L+LL E P   G+G+DIS  AL++A+ NA   G++ R    +S
Sbjct: 108 -DTV--LDIGSGSGCILLSLLAERPEATGLGIDISAPALDVARRNADRLGLAGRARFRRS 164

Query: 156 DWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR 215
           DW + V+  FD+IVSNPPYI++     L  E+RD++PR +L+ G DGL  YR IA    R
Sbjct: 165 DWLAEVDEQFDLIVSNPPYIDAATYATLAPELRDWEPRGALEAGADGLDAYRVIARDAPR 224

Query: 216 HLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            L   G   +EIG++Q   V  +  +     +   +D  G DRV+
Sbjct: 225 VLAPGGTLCLEIGHDQGRSVPALLAASGWRQITVQRDLIGKDRVV 269


>gi|188580161|ref|YP_001923606.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium populi BJ001]
 gi|179343659|gb|ACB79071.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylobacterium populi BJ001]
          Length = 296

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/226 (41%), Positives = 136/226 (60%), Gaps = 6/226 (2%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L  A  R L  E + RILG  +F+ +   LS DT  PRP+TE +V++AL    P  E++ 
Sbjct: 65  LGRAAARRLAGEPVARILGAWEFWGLPFALSPDTLVPRPDTESVVEAALGL-FPERERK- 122

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
            +R++DLGTG+G + +ALL E P   G+G+D +  AL +A++NA  NGV++R   L   W
Sbjct: 123 -LRLIDLGTGSGCILVALLHERPRAYGIGLDRAQGALAVARNNAAANGVADRASFLCGSW 181

Query: 158 FSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH- 216
             ++ G FD+IVSNPPYI + ++  L  EVR  DPR +LDGG DGL  YR I  G++R  
Sbjct: 182 LDALSGPFDLIVSNPPYIAAPVIATLEPEVRLHDPRAALDGGDDGLDAYRAILAGLARRP 241

Query: 217 --LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
             L+  G   +EIGY+Q   +  + ++     V   +D  GNDRV+
Sbjct: 242 GLLSAQGALVLEIGYDQGPALTDLAQAMGFADVRVGRDLAGNDRVV 287


>gi|145637545|ref|ZP_01793202.1| HemK [Haemophilus influenzae PittHH]
 gi|145269231|gb|EDK09177.1| HemK [Haemophilus influenzae PittHH]
          Length = 292

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 146/261 (55%), Gaps = 12/261 (4%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  VTG S  Q++   D+ +D++ R  LT  + R LK E I  ILG ++F+++ L +S 
Sbjct: 30  LLQHVTGKSRTQILAFDDTEIDEKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSK 89

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE-SPF------ 121
            T  PRP+TE LV+ AL  +L ++E+      ILDLGTGTGA+ LAL  E +P       
Sbjct: 90  STLIPRPDTESLVEKALQIALEKLEENPPHFHILDLGTGTGAIALALASELAPICQKRHI 149

Query: 122 -FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
             + +GVD+    + +A+SNA  N ++ +F  LQS WF ++ G FD+IVSNPPYI++   
Sbjct: 150 PLEIIGVDLMPDVVALAQSNAERNQLNVQF--LQSSWFDNITGKFDLIVSNPPYIDAQDE 207

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +V  F+P  +L     G +  R I +  S +LN +G+  +E G+ Q   V  IF 
Sbjct: 208 HLHQGDV-SFEPLSALVANDAGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFL 266

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                +V    DYG N+RV L
Sbjct: 267 ENYWEMVETVCDYGDNERVTL 287


>gi|294085499|ref|YP_003552259.1| methylase of polypeptide chain release factor [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665074|gb|ADE40175.1| Methylase of polypeptide chain release factor [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 289

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 134/235 (57%), Gaps = 4/235 (1%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLP 91
           D ++  L   + R +  E + RI GWR+F+++R  LSS T +PRP++E++V +A+A +  
Sbjct: 51  DMEKALLETLVARRIAREPVSRIRGWREFWSLRFALSSATLDPRPDSEIIVATAIAAAKA 110

Query: 92  R--IEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER 149
           R  +     +++LDLGTG+G + LA L E P   G+G+DIS  AL  A++NA   G++E+
Sbjct: 111 RSIVNPAKQLKLLDLGTGSGCLLLACLSELPDAVGLGLDISEDALATARNNATALGLAEQ 170

Query: 150 FDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
               Q  +   +   G FD+I+ NPPYI +  +  L  EV  ++P  +LDGG DGL  +R
Sbjct: 171 SRFYQHSFMDEMSQFGSFDIILCNPPYIPAAEITALEPEVARYEPMRALDGGADGLDCWR 230

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
            +   V   L   G   VEIG  Q+ DV+++ E   +  V   KD  G  R L+F
Sbjct: 231 GLMTVVPSCLAAGGCLVVEIGAGQEDDVIQLAEMANMTCVEMHKDLAGITRCLMF 285


>gi|154246563|ref|YP_001417521.1| HemK family modification methylase [Xanthobacter autotrophicus Py2]
 gi|154160648|gb|ABS67864.1| modification methylase, HemK family [Xanthobacter autotrophicus
           Py2]
          Length = 286

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 141/260 (54%), Gaps = 4/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L +  G +   +++  D+ +             R    E + RI G R+F+++ L
Sbjct: 29  DARLLLAQALGCAPGDLLLRADAPVPSEAEVTARAFTKRRAGGEPVARIRGRREFWSLDL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            LS DT  PRP+TE LV++ALA +LP  ++   + ILDLGTGTGA+  ALL E P   G+
Sbjct: 89  HLSPDTLVPRPDTETLVEAALA-ALP--DRTAPLSILDLGTGTGAILAALLVECPNATGI 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
            VD S  A   A++N   NG++ R   +  DW +++ G FD++VSNPPYI S  +  L  
Sbjct: 146 AVDRSEGAALTARANLARNGLAARAHVMVGDWGTALAGGFDLVVSNPPYITSSAMLDLPA 205

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR  DP ++L+ G DGL  Y  IA  + R + + G+  +E+G  Q+  V  +  +  L 
Sbjct: 206 EVRLHDPHLALEAGADGLLAYEAIAADLPRLVRRGGIAVLELGEGQEAAVAALVAAAGLE 265

Query: 246 LVN-AFKDYGGNDRVLLFCR 264
           +   A +D  G  R LL  R
Sbjct: 266 VAGPARRDLSGIPRALLARR 285


>gi|149914650|ref|ZP_01903180.1| modification methylase, HemK family, putative [Roseobacter sp.
           AzwK-3b]
 gi|149811443|gb|EDM71278.1| modification methylase, HemK family, putative [Roseobacter sp.
           AzwK-3b]
          Length = 278

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 122/212 (57%), Gaps = 9/212 (4%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  +LG+R+FY  R  + +   +PRPETE LV+ ALA +  R+        LDLGTG+
Sbjct: 70  EPMAHLLGYREFYGRRFAVDARVLDPRPETETLVERALAVAFSRV--------LDLGTGS 121

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVI 168
           G + L+LL E P   GVGVD+S  ALE+A+ NA    +S R + L SDWF++V G FD+I
Sbjct: 122 GCILLSLLAERPDATGVGVDLSEDALEVARRNAARLDLSARCEFLVSDWFAAVRGTFDLI 181

Query: 169 VSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG 228
           VSNPPYI +  +  L  E++ ++PR++L     GLS YR I       L + G   VEIG
Sbjct: 182 VSNPPYIAADEMAGLARELQ-YEPRMALTDEGCGLSAYRAIVAEAGACLVEGGRLIVEIG 240

Query: 229 YNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           + Q  DV  +  +     V    D  G DRV+
Sbjct: 241 WRQGADVADLMRAGGFAEVCVRPDLDGRDRVV 272


>gi|182677818|ref|YP_001831964.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633701|gb|ACB94475.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 306

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 139/258 (53%), Gaps = 7/258 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC   G+    +I DP   + D+ +  L     R L  E + RI+G R+F+++ L
Sbjct: 49  DARLLLCAALGIDHAGLIRDPAEPIGDKAKV-LDAFCRRRLAREPVSRIIGEREFWSLDL 107

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            L     +PRP+TE L+D      L  + KR     R+LDLGTG+GA+  ALL E P   
Sbjct: 108 KLDPAVLDPRPDTETLID----LVLREVGKRACPPQRVLDLGTGSGAILAALLTEWPEAF 163

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVGVD+S +   IA  N    G+ +R       W +++ G FD+IVSNPPYI    +D L
Sbjct: 164 GVGVDLSPRTCAIAAGNFARLGLGDRAAVFCGRWSAALSGRFDLIVSNPPYIVLDEIDTL 223

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV  +DPR++LDGG DG   YR +   ++  L + GL ++E G  Q   +  +  + +
Sbjct: 224 APEVSLYDPRLALDGGPDGFDAYRALLPPLASLLAEGGLVALECGAGQSPILQDLLRAAQ 283

Query: 244 LFLVNAFKDYGGNDRVLL 261
           L  ++   D  G++RV+L
Sbjct: 284 LEPMSIGLDLSGHERVVL 301


>gi|77920282|ref|YP_358097.1| putative protoporphyrinogen oxidase [Pelobacter carbinolicus DSM
           2380]
 gi|77546365|gb|ABA89927.1| [protein release factor]-glutamine N5-methyltransferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 287

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 143/258 (55%), Gaps = 11/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L    G+    + ++ D  L++ +       +V+  + E +  ILG  +F+++ 
Sbjct: 28  RDAELLLGASLGMDRVGLYLNFDRPLEESELTAYRALVVKRARREPLQYILGETEFWSLP 87

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++S     PRP+TE+LV+ AL  +       +  R+LD+GTG+GA+ +AL  E    + 
Sbjct: 88  LSVSPAVLIPRPDTEVLVEEALRVA-------NGSRVLDVGTGSGAIAIALAHELADAQV 140

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           V +DI  +AL +A  NA  NGV +R   L+ D     EG FD+IVSNPPYI +  +D L 
Sbjct: 141 VALDICPQALAVAADNARRNGVDDRVRFLERDLAQLPEGPFDLIVSNPPYIPAADLDGLM 200

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVRDF+PR +L+GG DGL  YR +A      L   G   VE+G +Q   V ++F+    
Sbjct: 201 PEVRDFEPRQALNGGQDGLDPYRLLAAQADTCLVPGGWLLVEVGIDQAAAVRQLFDDAG- 259

Query: 245 FLVNAF--KDYGGNDRVL 260
            LV+ F   DYGG  RV+
Sbjct: 260 -LVDGFVRDDYGGVPRVV 276


>gi|163793918|ref|ZP_02187892.1| Methylase of polypeptide chain release factor [alpha
           proteobacterium BAL199]
 gi|159181029|gb|EDP65546.1| Methylase of polypeptide chain release factor [alpha
           proteobacterium BAL199]
          Length = 294

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 125/222 (56%), Gaps = 5/222 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA-FSLPRIEKRDVVR 100
           + R L  E + RILG R F+ + L +  DT +PRP+TE L+++A+A F+    ++    R
Sbjct: 59  LARRLTREPVSRILGRRAFWTLDLIVGPDTLDPRPDTETLIEAAIAAFA----DREPPNR 114

Query: 101 ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS 160
           I+DLGTGTG + LA L   P   G+G+D S  A+EIA++NAV N +S R +    DW   
Sbjct: 115 IIDLGTGTGCLLLAALSAFPAATGLGIDKSKGAVEIARTNAVRNELSARAEFQTIDWDEL 174

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            +   D+I+SNPPYIE   +  L  EV  FDPR +L GG DGL  Y ++A  + R +   
Sbjct: 175 PQDRGDLILSNPPYIEEATLSALAPEVVQFDPRDALSGGADGLEAYDSLAGVLPRLMAPQ 234

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           G+  +E+G  Q+  V  +       +    KD G  +R L+ 
Sbjct: 235 GIAILELGAGQRSAVETLMIGVGFAVQEVRKDLGNIERALVL 276


>gi|255657439|ref|ZP_05402848.1| protein methyltransferase [Clostridium difficile QCD-23m63]
 gi|296449036|ref|ZP_06890826.1| protein-(glutamine-N5) methyltransferase [Clostridium difficile
           NAP08]
 gi|296879859|ref|ZP_06903832.1| protein-(glutamine-N5) methyltransferase [Clostridium difficile
           NAP07]
 gi|296262129|gb|EFH08934.1| protein-(glutamine-N5) methyltransferase [Clostridium difficile
           NAP08]
 gi|296429148|gb|EFH15022.1| protein-(glutamine-N5) methyltransferase [Clostridium difficile
           NAP07]
          Length = 282

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 142/259 (54%), Gaps = 7/259 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L +  G+    + ++ +  L + Q+          L    I  I+  R+F  +  
Sbjct: 24  DTELLLQKTLGVDRLYIHLNLNKELTEEQKTEFIGFAEERLNGRPIAYIVENREFMGLDF 83

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +      PRP+TE LV+  +       EK+DV  ILD+GTG+GA+ ++L K     K +
Sbjct: 84  FVKEGVLIPRPDTETLVEEIIEICR---EKKDV-SILDIGTGSGAITISLAKYIENSKIM 139

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG---LFDVIVSNPPYIESVIVDC 182
             DIS  ALEIAK NA+TN V E+   + SD F+++      FD+IVSNPPYI+   ++ 
Sbjct: 140 SFDISEIALEIAKKNAITNEVDEKIKYINSDLFTAISNSNIKFDIIVSNPPYIKKQDIET 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +V+D++P  +L+GG DGL  YR I +   ++LNK G+ + E+G+NQ  DV+ I +S 
Sbjct: 200 LHTQVKDYEPYNALEGGEDGLDFYRRITEQGKKYLNKFGILAYEVGHNQAEDVINIMKSN 259

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   KD  G DRV++
Sbjct: 260 GYKKIYTKKDIQGIDRVVI 278


>gi|27375330|ref|NP_766859.1| protoporphyrinogen oxidase [Bradyrhizobium japonicum USDA 110]
 gi|27348466|dbj|BAC45484.1| protoporphyrinogen oxidase [Bradyrhizobium japonicum USDA 110]
          Length = 297

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 124/219 (56%), Gaps = 4/219 (1%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEK-RDVVRIL 102
           R +  E + RILG R+F+ +   LS  T  PRP+TE +V+ AL   L R +K     RI 
Sbjct: 74  RRIAGEPVARILGTREFWGLPFRLSDATLVPRPDTETVVERAL--ELFREQKATQQPRIA 131

Query: 103 DLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE 162
           D+GTG+GA+ LALL + P   GVG D+S  ALE A+ NAVT G+++R   +   + +++ 
Sbjct: 132 DIGTGSGAILLALLHDIPGAFGVGTDLSLNALETARGNAVTLGLADRSAFVACSYLAALR 191

Query: 163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
           G FD+IVSNPPYI S  +  L LEVR+ DP ++LDGG DG   YR +    +  L   G 
Sbjct: 192 GPFDLIVSNPPYIPSAEIPKLSLEVREHDPHLALDGGNDGYDAYRALIPQAAERLAPGGA 251

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFK-DYGGNDRVL 260
             VE G  Q  ++  +  +  L +    K D  G  R +
Sbjct: 252 LIVEAGQGQARNIETLLTAAALVVDRPPKADLAGIPRAV 290


>gi|302671178|ref|YP_003831138.1| methyltransferase HemK [Butyrivibrio proteoclasticus B316]
 gi|302395651|gb|ADL34556.1| methyltransferase HemK [Butyrivibrio proteoclasticus B316]
          Length = 287

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/246 (36%), Positives = 134/246 (54%), Gaps = 7/246 (2%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L  V G     ++  PD  + D +R    + I R   HE +  ILG  +F 
Sbjct: 23  EAKLDARLLLEYVCGTDHSTLLAHPDKEVTDEERDKYLSMIDRRAAHEPVAYILGTWNFM 82

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
            +   ++SD   P  +TE+LV+ AL          D +R+LDL TG+G + L+LL  +  
Sbjct: 83  GLDFKVNSDVLIPEQDTEILVEEALR------NLEDGMRVLDLCTGSGCIALSLLNYTNE 136

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIV 180
            + V  DIS KAL +A  NA   G+S+R + +++D F     G FD+IVSNPPYI S ++
Sbjct: 137 TRAVCTDISDKALAVAGMNAERLGLSDRTEFVRTDLFPEESVGKFDLIVSNPPYIASKVI 196

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           D L  EVRD++PR++LDG  DGL  YR I +   + L   G   +EIGY+Q   V  + E
Sbjct: 197 DTLAPEVRDYEPRLALDGSEDGLVFYRRIIEETPKFLYSSGYLLLEIGYDQGQAVKEMLE 256

Query: 241 SRKLFL 246
            +K  +
Sbjct: 257 DKKYIM 262


>gi|260426432|ref|ZP_05780411.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Citreicella sp. SE45]
 gi|260420924|gb|EEX14175.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Citreicella sp. SE45]
          Length = 282

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 128/262 (48%), Gaps = 13/262 (4%)

Query: 3   ALRDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           A RD+   L  V G++  ++ +V PD V       + T  I R    E +  + G R+FY
Sbjct: 23  AARDARRLLAHVLGVAPGRLTLVLPDPVGAGAAGRYET-LIARRAAREPVSHLTGRREFY 81

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
                ++SD  +PRPETE LV  AL+            R+LDLGTGTG + L LL E   
Sbjct: 82  GRAFHVTSDVLDPRPETETLVAEALSAPF--------ARVLDLGTGTGCILLTLLAERAT 133

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNPPYIESV 178
             G+G D+S  AL +A  N    G+  R    Q  WF ++    G FD+IVSNPPYI   
Sbjct: 134 ATGIGTDLSEAALAVATRNRDALGLDGRATLGQGSWFEALPEGSGPFDLIVSNPPYIALD 193

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
            +  L  EVRD +P ++L  G DGL+ YR I      HL   G   VEIG  Q   V  +
Sbjct: 194 EMAGLSPEVRDHEPHMALTDGGDGLAAYRAITRDAPAHLAPGGRLMVEIGPTQGPAVAAL 253

Query: 239 FESRKLFLVNAFKDYGGNDRVL 260
                L  V   +D  G DRV+
Sbjct: 254 MTGAGLADVTVLQDLDGRDRVV 275


>gi|217978069|ref|YP_002362216.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylocella silvestris BL2]
 gi|217503445|gb|ACK50854.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylocella silvestris BL2]
          Length = 296

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 129/260 (49%), Gaps = 6/260 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC   GL    ++ DP + L  R    L     R L  E   RILG R+F+  R 
Sbjct: 35  DARLLLCAALGLDHAGLLRDPGAPLGARGAQALERMAARRLAREPTSRILGAREFWGARF 94

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L     +PRP+TE LV+  L       E     RILDLG G+GA+  ALL   P   GV
Sbjct: 95  HLGPAALDPRPDTETLVEVVL--DAVGAETGRAWRILDLGVGSGALLCALLASLPNAFGV 152

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL----FDVIVSNPPYIESVIVD 181
           GVD++  A  IA  N    G+  R   + +DW + +E      FD+IVSNPPYI    + 
Sbjct: 153 GVDLAPAACAIADRNLAAQGLQGRGKLICADWAAPLEARSAARFDIIVSNPPYISRGDIA 212

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR +DP ++LDGG DGL  YR +    +R L  +G  ++EIG  Q  DV  +   
Sbjct: 213 RLEPEVRIYDPLLALDGGEDGLDAYRAVIPTAARLLAPEGFVALEIGQGQGKDVDALLRD 272

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                 N   D GG +R++L
Sbjct: 273 ASFSARNFRLDLGGVERIIL 292


>gi|220930733|ref|YP_002507642.1| modification methylase, HemK family [Clostridium cellulolyticum
           H10]
 gi|220001061|gb|ACL77662.1| modification methylase, HemK family [Clostridium cellulolyticum
           H10]
          Length = 285

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 143/260 (55%), Gaps = 4/260 (1%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           + ++   LC+V       +    D  L   ++  L + +V+   +  +  I+G  +F ++
Sbjct: 23  VHEAGVMLCKVLKCGRTYLYSHGDRELSIDEKAVLDHMLVQRTGNIPLQYIVGDTEFMSL 82

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           R  ++     PR +TELLV+  +   L + +     ++LD+ TG+G + +++    P   
Sbjct: 83  RFLVTPAVLIPRQDTELLVEKTIDL-LNQGKTGTNKKVLDMCTGSGCIAVSIAYFCPECS 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVD 181
            V  D+S KAL++AK+N+  NGV  R +    D F +++G   FD+IVSNPPYIE+ I+ 
Sbjct: 142 IVACDVSQKALDVAKANSELNGVQNRVELCCGDLFDAIKGGQKFDIIVSNPPYIETDIIA 201

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++LDGG DGL  YR I       LN++G  + EIGYNQ   V  + + 
Sbjct: 202 GLQKEVRSYEPGLALDGGADGLVFYRRIISSAPERLNRNGWLAFEIGYNQGEKVSALMK- 260

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +  FKDYGGNDRV++
Sbjct: 261 ESFVDIQIFKDYGGNDRVVI 280


>gi|46202828|ref|ZP_00208676.1| COG2890: Methylase of polypeptide chain release factors
           [Magnetospirillum magnetotacticum MS-1]
          Length = 313

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 120/199 (60%), Gaps = 6/199 (3%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L  A  R L  E + RILG  +F+ +  +L  +T  PRP+TE +V++AL    P  E+  
Sbjct: 65  LGRAAERRLAGEPVARILGAWEFWGLPFSLGPETLVPRPDTESVVETALRL-FP--ERDR 121

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
            +R++DLGTG+G + +ALL E     G+G+D +  AL +A++NA  NGV  R   L+  W
Sbjct: 122 PLRLVDLGTGSGCILVALLHERLRAFGLGLDRAEGALRVARANAERNGVGARAAFLRGSW 181

Query: 158 FSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH- 216
             ++ G FD+IVSNPPYI + ++  L  EVR+ DP  +LDGG DGL  YR I  G++R  
Sbjct: 182 LDALVGPFDLIVSNPPYIAAPVIATLDTEVREHDPMAALDGGPDGLDAYRAILLGIARRP 241

Query: 217 --LNKDGLCSVEIGYNQKV 233
             L+  G   +EIGY+Q  
Sbjct: 242 DLLSPGGALVLEIGYDQAA 260


>gi|190151398|ref|YP_001969923.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|189916529|gb|ACE62781.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
          Length = 314

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 146/261 (55%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG +DF+++ L
Sbjct: 53  DANLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKDFWSLPL 112

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL +   R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 113 KVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDKAQI 172

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  E    LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 173 IGVDFKPEAVTLAETNRQNLGF-ENVRFLQSDWFSALENRQFDLIVSNPPYIDKQDENLQ 231

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GLS  + I +    +L  +G   +E G+ Q   V +IF+  +
Sbjct: 232 YGDVR-FEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFQQYQ 290

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              + +F+DYGGNDR+    R
Sbjct: 291 WDEIESFQDYGGNDRLTKAVR 311


>gi|146337702|ref|YP_001202750.1| putative methyltransferase hemK modifies release factors RF-1 and
           RF-2 [Bradyrhizobium sp. ORS278]
 gi|146190508|emb|CAL74507.1| Putative protein methyltransferase hemK modifies release factors
           RF-1 and RF-2 [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 124/222 (55%), Gaps = 18/222 (8%)

Query: 31  DDRQRFFLTNAIV-RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL--- 86
           DD QR    +A+V R L  E + RILG ++F+ + L LS+DT  PRP+TE +V+ AL   
Sbjct: 59  DDAQRL---DALVQRRLAGEPVARILGHKEFWGLELRLSADTLVPRPDTETVVELALDHL 115

Query: 87  ----AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
               A + P       +RI DLGTG+GA+ LALL E P   GVG DIS  AL  A+ NA 
Sbjct: 116 SAGGALTRP-------LRIGDLGTGSGAILLALLSELPRASGVGTDISIAALTTARENAR 168

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
             G+++R   +   + +++   FD+IVSNPPYI S  +  L  EV   DP  +LDGG DG
Sbjct: 169 ALGLNDRAAFVACSYATALAPPFDLIVSNPPYIPSADIAGLATEVHAHDPLRALDGGGDG 228

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
           L+ YRT+    +  L   G   VE+G  Q  DV  +     L
Sbjct: 229 LAAYRTLIPQAALLLQTGGAVIVEVGQGQSGDVAGLMTEAGL 270


>gi|303240124|ref|ZP_07326645.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acetivibrio cellulolyticus CD2]
 gi|302592393|gb|EFL62120.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acetivibrio cellulolyticus CD2]
          Length = 296

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 147/263 (55%), Gaps = 14/263 (5%)

Query: 7   SHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLT 66
           + + LC V G     +    D +L++ Q      AI R +  E +  I G ++F ++   
Sbjct: 41  AGAILCHVLGCDKAYLYSHDDYILNNSQFNSFLEAIKRRINGEPLQYITGSQEFMSLDFI 100

Query: 67  LSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVG 126
           +S D   PR +TE+LV+S + F+      +  + ILD+GTG+G + ++L       +   
Sbjct: 101 VSPDVLIPRQDTEILVESVIQFA----SGKGNIDILDVGTGSGCIAISLAYFIKNSRVTA 156

Query: 127 VDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGL 185
           VDIS  ALE+A+ NA   GV +R   ++S+ F +V  G FD+IVSNPPYI    ++ L  
Sbjct: 157 VDISKGALEMARKNAQKCGVEDRITFIESNLFDNVTSGDFDIIVSNPPYIPVQDIETLEK 216

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI----FES 241
           +V+DF+PR +LDGG DGL  YR I     R+L  +GL + E+GY+Q  +V++I    F++
Sbjct: 217 QVKDFEPRSALDGGCDGLDFYRRITKDSIRYLKPNGLLAFEVGYDQSQEVLKIMKDSFDN 276

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
            K+      +D  G +RV++  R
Sbjct: 277 LKI-----ERDLAGIERVVMGIR 294


>gi|307262577|ref|ZP_07544208.1| hypothetical protein appser13_70 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306872075|gb|EFN03788.1| hypothetical protein appser13_70 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 290

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 146/261 (55%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG +DF+++ L
Sbjct: 29  DANLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKDFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL +   R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDKAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  E    LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 149 IGVDFKPEAVTLAETNRQNLGF-ENVRFLQSDWFSALENRQFDLIVSNPPYIDKQDENLQ 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GLS  + I +    +L  +G   +E G+ Q   V +IF+  +
Sbjct: 208 YGDVR-FEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFQQYQ 266

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              + +F+DYGGNDR+    R
Sbjct: 267 WDEIESFQDYGGNDRLTKAVR 287


>gi|145634874|ref|ZP_01790581.1| HemK [Haemophilus influenzae PittAA]
 gi|145267740|gb|EDK07737.1| HemK [Haemophilus influenzae PittAA]
          Length = 292

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 143/265 (53%), Gaps = 12/265 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   TG    Q++   D+ +D++ R  LT  + R L  E I  ILG ++F+++ L
Sbjct: 26  DALVLLQYATGKPRTQILAFDDTEIDEKVRLKLTALLDRRLNGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKE------ 118
            +S  T  PRP+TE+LV+ AL  +L ++E+     RILDLGTGTGA+ LAL  E      
Sbjct: 86  NVSKGTLIPRPDTEILVEKALQIALVKLEENPPHFRILDLGTGTGAIALALASELSSICQ 145

Query: 119 --SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                 + +GVD+    + +A+SNA  N ++  F  LQS WF ++ G FD+I SNPPYI+
Sbjct: 146 KRQISLEIIGVDLMPDVVALAQSNAERNQLNVEF--LQSRWFENITGQFDLIASNPPYID 203

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L     G +  R I +    +LN +G   +E G+ Q   V 
Sbjct: 204 AQDEHLRQGDVR-FEPLSALVANDAGYADLRYIIESAPNYLNSNGALLLEHGWQQGEKVR 262

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
            IF      +V   +DYG N+RV L
Sbjct: 263 SIFLENHWEIVETVRDYGDNERVTL 287


>gi|326202287|ref|ZP_08192156.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium papyrosolvens DSM 2782]
 gi|325987405|gb|EGD48232.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium papyrosolvens DSM 2782]
          Length = 284

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 141/260 (54%), Gaps = 5/260 (1%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           ++++   LC+V       +    D  L   +R  L N + +  K+  +  I+G  +F ++
Sbjct: 23  VQEAGVMLCQVLNCGRAYLYAHGDRELSTDERAVLDNMLAQRAKNTPLQYIIGDTEFMSL 82

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           +  ++     PR +TE+LV+  +   L +      +++LD+ TG+G + +++    P   
Sbjct: 83  KFIVTPAVLIPRQDTEVLVEKVI--ELAKKSSNAGLKVLDMCTGSGCIAVSIAHFCPESS 140

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVD 181
            V  DIS +A+++AK+N+  NGV  R +    D F +++G   FD IVSNPPYIE+ I+ 
Sbjct: 141 IVACDISEEAIKVAKANSDLNGVQNRVEFFCGDLFEALKGSYKFDFIVSNPPYIETEIII 200

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++LDGG DGL  Y+ I      +LN  G  + EIG+NQ   V  + E 
Sbjct: 201 GLQKEVRSYEPELALDGGADGLDFYKIITVKAPEYLNNLGWLAFEIGFNQGERVSALME- 259

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   KDYGGNDRV++
Sbjct: 260 ESFINIQVIKDYGGNDRVVI 279


>gi|67459736|ref|YP_247360.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia felis URRWXCal2]
 gi|75535874|sp|Q4UJU4|HEMK_RICFE RecName: Full=Bifunctional methyltransferase; Includes: RecName:
           Full=HemK protein homolog; Includes: RecName: Full=tRNA
           (guanine-N(7)-)-methyltransferase; AltName:
           Full=tRNA(m7G46)-methyltransferase
 gi|67005269|gb|AAY62195.1| Methylase of polypeptide chain release factors, tRNA
           (guanine-N(7)-)-methyltransferase [Rickettsia felis
           URRWXCal2]
          Length = 527

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 143/266 (53%), Gaps = 24/266 (9%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I+G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEVEIEAFEKLLERRLKHEPIAYIIGIKEFYSREFIVNKHVLIPRADTEVL 102

Query: 82  VD---------------------SALAFSLPRIEKR--DVVRILDLGTGTGAVCLALLKE 118
           VD                     S +A S P    R  +  +IL+LGTG+G + ++LL E
Sbjct: 103 VDVCVHKSSLRATKRSVAISGILSKIASSTPMASSRNDEYTKILELGTGSGCIAISLLCE 162

Query: 119 SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIES 177
            P  + V  DIS  A+E+A++NA+   V++R   + S+WF ++ +  FDVIVSNPPYI +
Sbjct: 163 LPNARVVATDISLDAIEVARNNALKYHVTDRIQIIHSNWFENLGKQKFDVIVSNPPYIST 222

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                + LE  + +P I+L    DGL  YR IA+   + L  +G   +EIG+ Q+  V +
Sbjct: 223 DEKPEMALETLNHEPYIALFAEEDGLQAYRIIAENAKKFLKPNGKIVLEIGFKQEEAVTQ 282

Query: 238 IFESRKLFLVNAFKDYGGNDRVLLFC 263
           IF S    + + +KD  G+ RV+LF 
Sbjct: 283 IFLSNGYNIESVYKDLQGHSRVILFS 308


>gi|219870998|ref|YP_002475373.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Haemophilus parasuis SH0165]
 gi|219691202|gb|ACL32425.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Haemophilus parasuis SH0165]
          Length = 289

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 145/262 (55%), Gaps = 6/262 (2%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  D++  L  VT  S   +    ++ L++ +   L   + R  K E +  ILG ++F
Sbjct: 24  LNAKADANILLQAVTKRSKSAIFAFAETELNESELRQLAELLARRAKGEPMAYILGEKEF 83

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-S 119
           +++ L +S+ T  PRP+TE LV+ AL ++  R++    ++ILDLGTGTGA+ LAL  E  
Sbjct: 84  WSLPLAVSTATLIPRPDTERLVEVALEWAYKRLDSSKNLQILDLGTGTGAIALALASELG 143

Query: 120 PFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEGL-FDVIVSNPPYIES 177
              + +G+D    A+++A+ N    G    RF  LQSDWF +++   FD+IVSNPPYI+ 
Sbjct: 144 TKAEIIGIDKQPDAVQLAEKNRQKLGFENVRF--LQSDWFEALKNQRFDLIVSNPPYIDK 201

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
              +    +VR F+P  +L    +GLS  + I      +L  +G   +E G+ Q   V  
Sbjct: 202 DDENLTQGDVR-FEPLTALVAEQNGLSDLQKIIQNAPLYLTPNGALMLEHGWQQAASVQD 260

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           IF+  +   V  F+DYGGNDRV
Sbjct: 261 IFQQNQWNAVTTFQDYGGNDRV 282


>gi|113461091|ref|YP_719159.1| peptide release factor glutamine N(5)-methylase [Haemophilus somnus
           129PT]
 gi|112823134|gb|ABI25223.1| [protein release factor]-glutamine N5-methyltransferase
           [Haemophilus somnus 129PT]
          Length = 301

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 10/264 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   ++   +++L + +   LT  +VR  K E +  +LG  +F+ + L
Sbjct: 29  DANLLLQTVTKRSKSAILAFSETLLTEDELKQLTELLVRRAKGEPMAYVLGETEFWTLNL 88

Query: 66  TLSSDTFEPRPETELLVDSALA-FSLPRIEK---RDVVRILDLGTGTGAVCLAL---LKE 118
            ++  T  PRP+TE+LV+ AL    L +  K   +  +RILDLGTGTGA+ LAL   LK+
Sbjct: 89  QVAPYTLIPRPDTEILVEQALVCIQLLKKSKDFTQSSIRILDLGTGTGAIALALADELKK 148

Query: 119 S-PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIES 177
           S   F+  G+D+   A+++AK+NAV N ++E    LQS+WF  V G FD+IVSNPPYI++
Sbjct: 149 SGQHFEIFGLDVIADAVKLAKTNAVRNHLTE-VQFLQSNWFEQVTGQFDLIVSNPPYIDA 207

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   +VR F+P  +L     G +  + I +    +L K G   VE G+ Q   V  
Sbjct: 208 EDQHLNQGDVR-FEPLTALVAEKKGYADLQYIIEQAPNYLKKQGFLLVEHGWQQGQKVRS 266

Query: 238 IFESRKLFLVNAFKDYGGNDRVLL 261
            F  +    V    DYGGN+R+ L
Sbjct: 267 FFAEKLWKQVETINDYGGNERITL 290


>gi|170717667|ref|YP_001784743.1| HemK family modification methylase [Haemophilus somnus 2336]
 gi|168825796|gb|ACA31167.1| modification methylase, HemK family [Haemophilus somnus 2336]
          Length = 301

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 10/264 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   ++   +++L + +   LT  +VR  K E +  +LG  +F+ + L
Sbjct: 29  DANLLLQTVTKRSKSAILAFSETLLTEDELKQLTELLVRRAKGEPMAYVLGETEFWTLNL 88

Query: 66  TLSSDTFEPRPETELLVDSALA-FSLPRIEK---RDVVRILDLGTGTGAVCLAL---LKE 118
            ++  T  PRP+TE+LV+ AL    L +  K   +  +RILDLGTGTGA+ LAL   LK+
Sbjct: 89  QVAPYTLIPRPDTEILVEQALVCIQLLKKSKDFTQSPIRILDLGTGTGAIALALADELKK 148

Query: 119 S-PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIES 177
           S   F+  G+D+   A+++AK+NAV N ++E    LQS+WF  V G FD+IVSNPPYI++
Sbjct: 149 SGQHFEIFGLDVIADAVKLAKTNAVRNHLTE-VQFLQSNWFEQVTGQFDLIVSNPPYIDA 207

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   +VR F+P  +L     G +  + I +    +L K G   VE G+ Q   V  
Sbjct: 208 EDQHLNQGDVR-FEPLTALVAEKKGYADLQYIIEQAPNYLKKQGFLLVEHGWQQGQKVRS 266

Query: 238 IFESRKLFLVNAFKDYGGNDRVLL 261
            F  +    V    DYGGN+R+ L
Sbjct: 267 FFAEKLWKQVETINDYGGNERITL 290


>gi|126701108|ref|YP_001090005.1| protein methyltransferase [Clostridium difficile 630]
 gi|254977109|ref|ZP_05273581.1| protein methyltransferase [Clostridium difficile QCD-66c26]
 gi|255102694|ref|ZP_05331671.1| protein methyltransferase [Clostridium difficile QCD-63q42]
 gi|255308515|ref|ZP_05352686.1| protein methyltransferase [Clostridium difficile ATCC 43255]
 gi|255316189|ref|ZP_05357772.1| protein methyltransferase [Clostridium difficile QCD-76w55]
 gi|255518850|ref|ZP_05386526.1| protein methyltransferase [Clostridium difficile QCD-97b34]
 gi|255652029|ref|ZP_05398931.1| protein methyltransferase [Clostridium difficile QCD-37x79]
 gi|260685004|ref|YP_003216289.1| protein methyltransferase [Clostridium difficile CD196]
 gi|260688662|ref|YP_003219796.1| protein methyltransferase [Clostridium difficile R20291]
 gi|306521771|ref|ZP_07408118.1| protein methyltransferase [Clostridium difficile QCD-32g58]
 gi|115252545|emb|CAJ70388.1| Modification methylase HemK [Clostridium difficile]
 gi|260211167|emb|CBA66623.1| protein methyltransferase [Clostridium difficile CD196]
 gi|260214679|emb|CBE07316.1| protein methyltransferase [Clostridium difficile R20291]
          Length = 282

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 141/259 (54%), Gaps = 7/259 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L +  G+    + ++ +  L + Q+          L    I  I+  R+F  +  
Sbjct: 24  DTELLLQKTLGVDRLYIHLNLNKELTEEQKTKFMGFAEERLNGRPIAYIVENREFMGLDF 83

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +      PRP+TE LV+  +       EK+DV  ILD+GTG+GA+ ++L K     K +
Sbjct: 84  FVKEGVLIPRPDTETLVEEIIEICR---EKKDV-SILDIGTGSGAITISLAKYIENSKIM 139

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG---LFDVIVSNPPYIESVIVDC 182
             DIS  ALEIAK NA+ N V E+   + SD F+++      FD+IVSNPPYI+   ++ 
Sbjct: 140 SFDISETALEIAKKNAIINEVGEKIKYINSDLFTAISDSNIKFDIIVSNPPYIKKQDIET 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +V+D++P  +L+GG DGL  YR I +   ++LNK G+ + E+G+NQ  DV+ I +S 
Sbjct: 200 LHKQVKDYEPYNALEGGEDGLDFYRRITEQGKKYLNKCGILAYEVGHNQAEDVINIMKSN 259

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   KD  G DRV++
Sbjct: 260 GYKKIYTKKDIQGIDRVVI 278


>gi|332161452|ref|YP_004298029.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|318605429|emb|CBY26927.1| methylase of polypeptide chain release factors [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665682|gb|ADZ42326.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
          Length = 284

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   +S L   Q   L     R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLSFVTGRARTYLLAFGESQLTAEQLAVLEPLAARREQGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P F  
Sbjct: 82  LSVSSATLIPRPDTECLVEQALAH-LPATP----CRILDLGTGTGAIALALASERPDFAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +GVDI   A+ +A+ NA    ++   D LQS WF SV G F +IVSNPPYI++       
Sbjct: 137 MGVDIKADAVALARHNAKKLAIN-NVDFLQSSWFDSVSGRFTLIVSNPPYIDANDPHLNE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L   G   +E G+ Q   V ++  +   
Sbjct: 196 GDVR-YEPHSALVAEAEGIADLAEIIRQSPAYLEVGGWLILEHGWQQATAVQKLLNNSGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V  +KDYG NDRV L
Sbjct: 255 SAVMTYKDYGNNDRVTL 271


>gi|126736398|ref|ZP_01752140.1| modification methylase, HemK family protein [Roseobacter sp. CCS2]
 gi|126714219|gb|EBA11088.1| modification methylase, HemK family protein [Roseobacter sp. CCS2]
          Length = 288

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 134/258 (51%), Gaps = 8/258 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+       +G+++ ++ +     ++D  +      I R  + E +  + G R FY 
Sbjct: 26  AARDARKLFAFASGVAAGRLTLILPEPVNDAVKTRFDALIARRSRFEPVSHLTGTRAFYG 85

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               ++ D  +PRPETE L+++AL        +    R+LDLGTG+G + + LL E+P  
Sbjct: 86  RDFEVTKDVLDPRPETETLIEAAL--------RDPFARVLDLGTGSGCILVTLLAENPKA 137

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
            GVG D S  AL +A  NA  +GV +R   +QSDW ++++  FD+IV+NPPYI +  +  
Sbjct: 138 VGVGGDASAVALTVALRNAQRHGVDDRATFVQSDWMAAIKRRFDLIVANPPYIAADEMAG 197

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +VR+++PR++L    DGLS YRTI       L   G    EIG  Q   V  +    
Sbjct: 198 LSRDVREWEPRMALTDEADGLSAYRTIIKQAGDALIPGGRLMCEIGSTQGHAVAELMIRA 257

Query: 243 KLFLVNAFKDYGGNDRVL 260
            L  V    D  G DRV+
Sbjct: 258 GLRHVGVIPDLDGRDRVV 275


>gi|167855821|ref|ZP_02478573.1| HemK-like protein [Haemophilus parasuis 29755]
 gi|167853034|gb|EDS24296.1| HemK-like protein [Haemophilus parasuis 29755]
          Length = 416

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 144/261 (55%), Gaps = 4/261 (1%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  D++  L  VT  S   +    ++ L++ +   L   + R  K E +  ILG ++F
Sbjct: 151 LNAKADANILLQAVTKRSKSAIFAFAETELNESELRQLAELLARRAKGEPMAYILGEKEF 210

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-S 119
           +++ L +S+ T  PRP+TE LV+ AL ++  R++    ++ILDLGTGTGA+ LAL  E  
Sbjct: 211 WSLPLAVSTATLIPRPDTERLVEVALEWAYKRLDSSKNLQILDLGTGTGAIALALASELG 270

Query: 120 PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESV 178
              + +G+D    A+++A+ N    G  E    LQSDWF +++   FD+IVSNPPYI+  
Sbjct: 271 TKAEIIGIDKQPDAVQLAEKNRQKLGF-ENVRFLQSDWFEALKNQRFDLIVSNPPYIDKD 329

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
             +    +VR F+P  +L    +GLS  + I      +L  +G   +E G+ Q   V  I
Sbjct: 330 DENLTQGDVR-FEPLTALVAEQNGLSDLQKIIQNAPLYLTPNGALMLEHGWQQAASVQDI 388

Query: 239 FESRKLFLVNAFKDYGGNDRV 259
           F+  +   V  F+DYGGNDRV
Sbjct: 389 FQQNQWNAVTTFQDYGGNDRV 409


>gi|308271576|emb|CBX28184.1| Protein methyltransferase hemK [uncultured Desulfobacterium sp.]
          Length = 307

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 137/255 (53%), Gaps = 5/255 (1%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L    G     + +  D  L+  +R    + I R +  E +  I+G ++F+++ L +S 
Sbjct: 47  LLAHTLGFKRIDLYLRHDQPLNVGERNLFKSLIRRRISKEPVAYIVGSKEFWSLELVVSK 106

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRPETE LV+ AL   L + +     RIL+LGTG+GA+ LA+  ++P  +    DI
Sbjct: 107 DVLIPRPETECLVEEAL-LVLDKDKVSAPKRILELGTGSGAIILAMATQNPDQQYFASDI 165

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE---GLFDVIVSNPPYIESVIVDCLGLE 186
           S  AL +A +NA   G+ E+ D     W S ++    LFD+I+SNPPYI    +  L  E
Sbjct: 166 SINALAVALNNARHLGLDEKIDLFCGSWVSPLKENNNLFDIIISNPPYIRRGDIKTLQPE 225

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           +  F+P  +LDGG DGL+  + I     + LNK G   +EIGY+QK  V  I +    + 
Sbjct: 226 INRFEPINALDGGEDGLACIKHIIKNAHKFLNKSGTLLLEIGYDQKKAVDEIIKETGRYA 285

Query: 247 VNAF-KDYGGNDRVL 260
             +F KDY G DRV+
Sbjct: 286 QASFRKDYSGFDRVV 300


>gi|144897746|emb|CAM74610.1| modification methylase, HemK family [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 281

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 137/260 (52%), Gaps = 5/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +    G+   +++  P+ VL  +Q+  +     R    + I  ILG R F+ + L
Sbjct: 26  DARLLVAEALGVEPLRLVTHPEMVLTAQQQTAIEGMAARREDRQPISHILGRRGFWTLDL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFKG 124
            ++ DT +PRP+TE LV   L     R+  R   +RI+D GTG+G + LALL E P   G
Sbjct: 86  RVTPDTLDPRPDTETLVQGVL----DRVADRHAALRIVDFGTGSGCILLALLAELPNAHG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +G+D S  AL +A  NA  NG++ R +    DW   ++G FD+IVSNPPYI    +  L 
Sbjct: 142 LGIDQSAAALAVAAENAERNGLAGRAEFRHGDWGRGLDGPFDIIVSNPPYIPEADIAGLE 201

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV   +PR +L GG DGL  YR +A  ++R L   G+  +E+G  Q  DV  + ++  L
Sbjct: 202 PEVARHEPRSALVGGADGLDCYRALAPDIARLLAVGGITGLEVGAGQDSDVAALLKAAGL 261

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
             +    D  G+ R +   R
Sbjct: 262 RDLCVADDLAGHGRSVFAAR 281


>gi|330863232|emb|CBX73358.1| protein methyltransferase hemK [Yersinia enterocolitica W22703]
          Length = 279

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   +S L   Q   L     R  + E I  ++G R+F+++ 
Sbjct: 17  RDAEILLSFVTGRARTYLLAFGESQLTAEQLAVLEPLAARREQGEPIAYLVGEREFWSLP 76

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P F  
Sbjct: 77  LSVSSATLIPRPDTECLVEQALAH-LPATP----CRILDLGTGTGAIALALASERPDFAV 131

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +GVDI   A+ +A+ NA    ++   D LQS WF SV G F +IVSNPPYI++       
Sbjct: 132 MGVDIKADAVALARHNAKKLAIN-NVDFLQSSWFDSVSGRFTLIVSNPPYIDANDPHLNE 190

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L   G   +E G+ Q   V ++  +   
Sbjct: 191 GDVR-YEPHSALVAEAEGIADLAEIIRQSPAYLEVGGWLILEHGWQQATAVQKLLNNSGF 249

Query: 245 FLVNAFKDYGGNDRVLL 261
             V  +KDYG NDRV L
Sbjct: 250 SAVMTYKDYGNNDRVTL 266


>gi|32033820|ref|ZP_00134105.1| COG2890: Methylase of polypeptide chain release factors
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209496|ref|YP_001054721.1| HemK-like protein [Actinobacillus pleuropneumoniae L20]
 gi|303251819|ref|ZP_07337990.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307244798|ref|ZP_07526897.1| hypothetical protein appser1_120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249119|ref|ZP_07531126.1| hypothetical protein appser2_20810 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307249195|ref|ZP_07531192.1| hypothetical protein appser4_120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253752|ref|ZP_07535606.1| hypothetical protein appser9_120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258209|ref|ZP_07539952.1| hypothetical protein appser11_120 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260447|ref|ZP_07542142.1| hypothetical protein appser12_230 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126098288|gb|ABN75116.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
 gi|302649249|gb|EFL79434.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306854243|gb|EFM86449.1| hypothetical protein appser1_120 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854407|gb|EFM86603.1| hypothetical protein appser2_20810 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306858719|gb|EFM90778.1| hypothetical protein appser4_120 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306863236|gb|EFM95176.1| hypothetical protein appser9_120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867669|gb|EFM99514.1| hypothetical protein appser11_120 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869850|gb|EFN01632.1| hypothetical protein appser12_230 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 290

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 146/261 (55%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG ++F+++ L
Sbjct: 29  DANLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL +   R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDKAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  E    LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 149 IGVDFKPEAVTLAETNRQNLGF-ENVRFLQSDWFSALENRQFDLIVSNPPYIDKQDKNLQ 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GLS  + I +    +L  +G   +E G+ Q   V +IF+  +
Sbjct: 208 YGDVR-FEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFKQYQ 266

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              + +F+DYGGNDR+    R
Sbjct: 267 WDEIESFQDYGGNDRLTKAVR 287


>gi|298292695|ref|YP_003694634.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Starkeya novella DSM 506]
 gi|296929206|gb|ADH90015.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Starkeya novella DSM 506]
          Length = 283

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 128/231 (55%), Gaps = 3/231 (1%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           R++ + L    GL+   ++   D  + +     L     R    E + R++G R+F+++ 
Sbjct: 25  REARALLKGGLGLADIDLVARADLPVAEEDAARLRALAARRADGEPLARLVGRREFWSLD 84

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            +L+ +T  PRPETE LV++ALA    R  K   +RILDLGTGTGA+  ALL E P   G
Sbjct: 85  FSLAPETLVPRPETETLVEAALALFPDRAAK---LRILDLGTGTGAILAALLSEYPNAVG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +G+D+S  A   A+ N    G++ R   +   W  ++   FD++ SNPPYI +  +  L 
Sbjct: 142 LGIDLSEGAARQARDNLARLGLAGRSAVIVGRWAEAIHSRFDLVASNPPYIPARDIAALD 201

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDV 235
            EVR+ DPR++LDGG DGL  YR +A  +   L   G   +E+G  Q+ DV
Sbjct: 202 KEVREHDPRLALDGGADGLDAYRVLAAALPGLLVPGGRAVLELGIGQEEDV 252


>gi|322513488|ref|ZP_08066598.1| protein methyltransferase HemK [Actinobacillus ureae ATCC 25976]
 gi|322120707|gb|EFX92591.1| protein methyltransferase HemK [Actinobacillus ureae ATCC 25976]
          Length = 290

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 146/261 (55%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    ++ L   +   L   +   L+ E +  ILG ++F+++ L
Sbjct: 29  DANILLQAVTKRSKSAIFAFSETELSQTEMSQLETLLTCRLQGEPMAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL ++  R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPHTLIPRPDTERLVEVALEWAYKRLEIQKTLQILDLGTGTGAIALALASELGDQAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  +    LQSDWFS++E   F++IVSNPPYI+    +  
Sbjct: 149 IGVDFKPEAVVLAETNRQNLGF-QNVTFLQSDWFSALENQQFELIVSNPPYIDKQDENLK 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    DGLS  + I     R+L  +G   +E G+ Q   V +IF+  +
Sbjct: 208 YGDVR-FEPLSALVAEQDGLSDLQKIIKNAPRYLANNGALMLEHGWQQAQAVQQIFQQYQ 266

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              + +F+DYGGNDR+    R
Sbjct: 267 WDEIASFQDYGGNDRMTKAVR 287


>gi|154252200|ref|YP_001413024.1| HemK family modification methylase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156150|gb|ABS63367.1| modification methylase, HemK family [Parvibaculum lavamentivorans
           DS-1]
          Length = 283

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 143/258 (55%), Gaps = 4/258 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +  VTG +  ++I +P + +   +   L     R L  E + RILG R+F+ +  
Sbjct: 26  DARILVQAVTGATDIEMIREPAAPISAAEEEALAGFERRRLAREPVSRILGAREFWGLAF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++S T +PRP++E L++++L    P    R    +LDLGTGTG + L LL E P   G+
Sbjct: 86  AVTSATLDPRPDSETLIEASLKCLAPLARPR----LLDLGTGTGCLLLTLLHERPDASGI 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS +AL++A+ N+   G++ R      +W   +   FD+++SNPPYI S  ++ L  
Sbjct: 142 GVDISEEALQVARENSARLGLAARARFQPGNWMEGLGEKFDLVISNPPYIASGEIEVLEP 201

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR  DPR++LDGG DGL  YR IA  +   L ++G+  VE+G  Q   V  IFE+    
Sbjct: 202 EVRGHDPRLALDGGADGLDAYRAIAAALPDVLTQEGVAVVELGAGQADAVRGIFEAAGCA 261

Query: 246 LVNAFKDYGGNDRVLLFC 263
           ++    D  G  R L+  
Sbjct: 262 VLRVDPDLSGVPRALVAA 279


>gi|303250477|ref|ZP_07336674.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307251518|ref|ZP_07533425.1| hypothetical protein appser6_420 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650465|gb|EFL80624.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306860982|gb|EFM92988.1| hypothetical protein appser6_420 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 290

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 146/261 (55%), Gaps = 4/261 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  +   +    ++ L   +   L   + R L+ E +  ILG ++F+++ L
Sbjct: 29  DANLLLQAVTKRTKSAIFAFGETALHQTELAELAQLLARRLQGEPMAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL +   R+E +  ++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDKAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A++N    G  E    LQSDWFS++E   FD+IVSNPPYI+    +  
Sbjct: 149 IGVDFKPEAVTLAETNRQNLGF-ENVRFLQSDWFSALENRQFDLIVSNPPYIDKQDKNLQ 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GLS  + I +    +L  +G   +E G+ Q   V +IF+  +
Sbjct: 208 YGDVR-FEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFKQYQ 266

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              + +F+DYGGNDR+    R
Sbjct: 267 WDEIESFQDYGGNDRLTKAVR 287


>gi|320102130|ref|YP_004177721.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Isosphaera pallida ATCC 43644]
 gi|319749412|gb|ADV61172.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Isosphaera pallida ATCC 43644]
          Length = 319

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 144/257 (56%), Gaps = 3/257 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L  V   + +Q+ +  D V+ D  R    + + R  + E    ++G ++FY +  
Sbjct: 56  EAEVLLAHVLDHARYQLYMHIDDVVSDAARSAFRDLVKRRSEGEPSAYLVGRKEFYALSF 115

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PRP++E LV  AL  +L ++  R+  R+ D+GTG+G + +A+ + SP  + V
Sbjct: 116 KVTPAVLIPRPDSEFLVIEALE-ALGKMVGRETPRLADVGTGSGCLAVAVARRSPQVRIV 174

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCL 183
            +D S +AL +A+ NA  +GV++R D  + D F  +  E  FD+IVSNPPY+ + + + L
Sbjct: 175 AIDRSAEALAVARENAQAHGVADRIDFCEGDLFEPLDPEDRFDLIVSNPPYVATPVWETL 234

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
              +++F+PR++LDGGIDGL   R + D  +  L+  G  ++EIG +Q   V R+F    
Sbjct: 235 EPTIKNFEPRLALDGGIDGLDVIRRLVDQAAVRLHPGGTLAMEIGSDQGEAVTRLFAGDL 294

Query: 244 LFLVNAFKDYGGNDRVL 260
                  +D+ G DRV+
Sbjct: 295 WSPPTIRRDHAGLDRVV 311


>gi|291520550|emb|CBK75771.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Butyrivibrio fibrisolvens 16/4]
          Length = 276

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 137/260 (52%), Gaps = 7/260 (2%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  D+   L  V+G++  Q  +     + +   +     ++R   H  +  I G +DF
Sbjct: 20  LDAKIDAWLLLSFVSGITKAQYFLKQSEEIPENTLYKYKEVLLRRASHVPLQHITGEQDF 79

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
             +   ++     PR +TE LV+ AL   +P         +LDL TG+G V ++L+    
Sbjct: 80  MGLTFWVNEHVLIPRQDTETLVEEALKV-IPSGS-----HVLDLCTGSGCVIISLVALGQ 133

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
              G+GVDIS  AL +A+ N  T  V ++    + D F+ V+G F+ IVSNPPYI + +V
Sbjct: 134 GLSGIGVDISEDALVVARENG-TRIVGKKVAFEKGDLFTGVQGRFNAIVSNPPYIPTAVV 192

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           + L +EV+D +PR++LDG  DGL  YR I      +LN+ G   VEIGY+Q  DV ++F 
Sbjct: 193 EGLAVEVKDHEPRLALDGTEDGLLFYRRITASAQDYLNEGGWLLVEIGYDQGQDVSKLFT 252

Query: 241 SRKLFLVNAFKDYGGNDRVL 260
                 V   +D  GNDRV+
Sbjct: 253 DAGFKDVEVVQDLAGNDRVV 272


>gi|310816144|ref|YP_003964108.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ketogulonicigenium vulgare Y25]
 gi|308754879|gb|ADO42808.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ketogulonicigenium vulgare Y25]
          Length = 276

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 139/263 (52%), Gaps = 10/263 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           A RD+   L    G++  ++ +V PD V++  Q      AI +  K + + +I+G R FY
Sbjct: 23  AARDARLLLAHALGVAPDRLTLVLPD-VVNAAQADAFHAAIAQRAKRQPVAQIIGQRMFY 81

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
                ++ DT +PRPETE+L+ +ALA        +   R+LD+GTGTG + L LL E+  
Sbjct: 82  GRNFLVTPDTLDPRPETEVLIAAALA--------QPFTRVLDIGTGTGCILLTLLAENQQ 133

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G GVD+S  AL++A+ NAV  G+  R +   SDW  +  G FD+IVSNPPYI    + 
Sbjct: 134 AVGQGVDLSPAALDVAQRNAVALGLDTRAEFSLSDWGMAATGRFDLIVSNPPYIALDEMA 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EV  ++P ++L  G DGL+ YR I     R L+  G   VE G  Q   +  I ++
Sbjct: 194 GLSPEVTGWEPAMALTDGGDGLAAYRAILADAPRLLSDAGRVIVEFGPTQADAIRAIGDA 253

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
                     D  G DR L+F +
Sbjct: 254 AGFTSAQLHHDLDGRDRCLVFSQ 276


>gi|332306090|ref|YP_004433941.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173419|gb|AEE22673.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 287

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 136/263 (51%), Gaps = 10/263 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  DS   +C+V   ++  ++  P+  LD  Q     + + +  +   +  +LG+RDF++
Sbjct: 30  AATDSRLLMCQVLQCNTVYLMTWPEKPLDAAQLRAFEHLVEKRKQGHPVAYLLGYRDFWS 89

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL +S  T  PRPETELLV++AL   L      +   +LDLGTGTGA+ LAL  E P +
Sbjct: 90  LRLQVSPATLIPRPETELLVETALDLPL-----NNEANVLDLGTGTGAIALALASEKPDW 144

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
           +  G+D +  A+ +AK N   N +   RF   QSDWFS++    FD+IVSNPPY+E   V
Sbjct: 145 QVAGIDKNADAVALAKQNGQANKLPHVRFT--QSDWFSNLSAASFDLIVSNPPYVEQSSV 202

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P  +L  G DGL   R I      +L  +     E G+ Q   V  +  
Sbjct: 203 YLQQGDVR-FEPASALTSGEDGLDDIRFIIPNAIEYLAPNAWLVFEHGHLQAQGVQALLR 261

Query: 241 SRKLFLVNAFKDYGGNDRVLLFC 263
                 V +  D  G+ RV L C
Sbjct: 262 ENSFEQVRSVSDLNGHPRVTLGC 284


>gi|300716407|ref|YP_003741210.1| protein methyltransferase [Erwinia billingiae Eb661]
 gi|299062243|emb|CAX59360.1| Protein methyltransferase [Erwinia billingiae Eb661]
          Length = 276

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 138/257 (53%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DS L   Q   L + + R    E +  + G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRSWIIAFDDSELSAEQLSQLDDLLARRANGEPVAYLTGQREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++S DT  PRP+TELLV+ ALA  LP         +LDLGTGTGA+ LA+  E P  + 
Sbjct: 82  LSVSPDTLIPRPDTELLVEQALAH-LPETAS----TVLDLGTGTGAIALAIASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
            GVD    A+ +A+SNA   G++  RF    S+WFS+V G  F +IVSNPPYI++     
Sbjct: 137 TGVDRIAAAVSLAESNAQRLGITNARFRL--SNWFSAVSGEQFTLIVSNPPYIDAEDQHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L    +GL+  + IA     +L   G   +E G+ Q   V  I +  
Sbjct: 195 QQGDVR-FEPDSALIAADNGLADIKQIAAEAGHYLLPGGWLLLEHGWQQAEAVRAILQQN 253

Query: 243 KLFLVNAFKDYGGNDRV 259
               V   KDYGGNDRV
Sbjct: 254 HFVSVATAKDYGGNDRV 270


>gi|315634082|ref|ZP_07889371.1| protein methyltransferase HemK [Aggregatibacter segnis ATCC 33393]
 gi|315477332|gb|EFU68075.1| protein methyltransferase HemK [Aggregatibacter segnis ATCC 33393]
          Length = 299

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 142/270 (52%), Gaps = 15/270 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VT  S   ++   ++ LD++ +  LT  + R L+ E I  +LG ++F+++ L
Sbjct: 26  DAQVLLQFVTQKSRAFILAFGETALDEKTQEKLTALLSRRLQGEPIAYLLGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEK----RDVVRILDLGTGTGAVCLALLKE-SP 120
            +S+ T  PRP+TE+LV+ A+A S   ++K        RILDLGTGTGA+ LAL  E  P
Sbjct: 86  NVSAGTLIPRPDTEILVEKAVAISAEALQKCGQNSQCFRILDLGTGTGAIALALASELKP 145

Query: 121 FFKG-------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
             +        +GVD+    + +A SNA  N +   F  LQS WF  + G FD+IVSNPP
Sbjct: 146 IAQKQQIQLEVIGVDVMPNVVALATSNAEKNQLGVSF--LQSHWFDKMTGTFDLIVSNPP 203

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI++        +VR F+P  +L    +G +  R I     + +   G   VE G+ Q  
Sbjct: 204 YIDAKDEHLTQGDVR-FEPLSALVAEEEGYADLRHIIANAPKFMRTGGYLLVEHGWQQGE 262

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
            V  IF+      +   +DYG N+RV L C
Sbjct: 263 KVRSIFQENFWTSIETLRDYGNNERVTLGC 292


>gi|253997607|ref|YP_003049671.1| HemK family modification methylase [Methylotenera mobilis JLW8]
 gi|253984286|gb|ACT49144.1| modification methylase, HemK family [Methylotenera mobilis JLW8]
          Length = 292

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 131/245 (53%), Gaps = 14/245 (5%)

Query: 17  LSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRP 76
           L +H+  V P SV  D +       + R L  E +  ILG+R+FY + L +S DT  PRP
Sbjct: 46  LLAHEQDVLPASVSADFETL-----LTRRLAGEPVAYILGYREFYGLNLKVSPDTLIPRP 100

Query: 77  ETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEI 136
           +TE LV++ALA    +I       ILDLGTGTGAV LA+ +  P  +   VD S  AL I
Sbjct: 101 DTETLVEAALA----KIPTDTDYTILDLGTGTGAVALAIAQHRPHTQVTAVDASQGALHI 156

Query: 137 AKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRI 194
           A+ NA   G+++ RF    S WFS+VE   F++I+SNPPYIE         ++R F+P  
Sbjct: 157 AEHNAQQLGLTQVRFSL--SHWFSAVESERFNLIISNPPYIEQHDPHLGQGDLR-FEPIS 213

Query: 195 SLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYG 254
           +L  G+DGL   R I      HL   G   +E GYNQ   V  +     L  +   KD G
Sbjct: 214 ALASGVDGLDDIREIIAHSLIHLQPQGWLMLEHGYNQAHLVADLMAESGLVDIETIKDLG 273

Query: 255 GNDRV 259
            NDRV
Sbjct: 274 ANDRV 278


>gi|261496508|ref|ZP_05992888.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261307711|gb|EEY09034.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
          Length = 363

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 142/256 (55%), Gaps = 4/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    ++VL +R+   L   + R  K E +  ILG+R+F+++ L
Sbjct: 104 DANLLLQAVTKRSKSAIFAFSETVLSERELVELAEKLARRAKGEPMAYILGYREFWSLPL 163

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL ++  R+E + +++ILDLGTGTGA+ LAL  E     + 
Sbjct: 164 KVSPATLIPRPDTERLVELALEYANKRLENQKMLQILDLGTGTGAIALALASELGEKAQI 223

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+++A+ N    G+++    LQSDWFSS+    FD+IVSNPPYI+    +  
Sbjct: 224 IGVDFQNEAVQLAEENRQHLGLNQ-VTFLQSDWFSSLANQQFDLIVSNPPYIDEADENLT 282

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GLS  + I      +L   G   +E  + Q   V  +F+   
Sbjct: 283 VGDVR-FEPLTALVADNKGLSDLQKIIQNAPLYLKPQGALMLEHSWQQGNAVRDLFDLNL 341

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DY GNDRV
Sbjct: 342 WEQVETAQDYAGNDRV 357


>gi|261493249|ref|ZP_05989776.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261311099|gb|EEY12275.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 417

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 144/261 (55%), Gaps = 4/261 (1%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  D++  L  VT  S   +    ++VL +R+   L   + R  K E +  ILG+R+F
Sbjct: 153 LNAKFDANLLLQAVTKRSKSAIFAFSETVLSERELVELAEKLARRAKGEPMAYILGYREF 212

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-S 119
           +++ L +S  T  PRP+TE LV+ AL ++  R+E + +++ILDLGTGTGA+ LAL  E  
Sbjct: 213 WSLPLKVSPATLIPRPDTERLVELALEYANKRLENQKMLQILDLGTGTGAIALALASELG 272

Query: 120 PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESV 178
              + +GVD   +A+++A+ N    G+++    LQSDWFSS+    FD+IVSNPPYI+  
Sbjct: 273 EKAQIIGVDFQNEAVQLAEENRQHLGLNQ-VTFLQSDWFSSLANQQFDLIVSNPPYIDEA 331

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
             +    +VR F+P  +L     GLS  + I      +L   G   +E  + Q   V  +
Sbjct: 332 DENLTVGDVR-FEPLTALVADNKGLSDLQKIIQNAPLYLKPQGALMLEHSWQQGNAVRDL 390

Query: 239 FESRKLFLVNAFKDYGGNDRV 259
           F+      V   +DY GNDRV
Sbjct: 391 FDLNLWEQVETAQDYAGNDRV 411


>gi|210623299|ref|ZP_03293716.1| hypothetical protein CLOHIR_01666 [Clostridium hiranonis DSM 13275]
 gi|210153700|gb|EEA84706.1| hypothetical protein CLOHIR_01666 [Clostridium hiranonis DSM 13275]
          Length = 293

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 131/220 (59%), Gaps = 8/220 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTG 109
           I  I+G R+F  +   +      PRP+TE LVD  +  +S    +++D + ILD+GTG+G
Sbjct: 75  IAYIVGNREFMGLDFYVQEGVLIPRPDTETLVDEIIRIYSEEEYKQKDRIDILDIGTGSG 134

Query: 110 A--VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG---L 164
           A  V LA   ++ F K    DIS  ALEI   NA TN V +R + ++SD FS++EG   +
Sbjct: 135 AITVSLAYYIKNSFVKSF--DISDIALEIGAKNAATNSVEDRTEFIKSDVFSALEGEGEI 192

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
            D+IVSNPPYI   ++  L  +V+D++P  +L+GG DGL  YR+I +G  ++L K G+ +
Sbjct: 193 LDIIVSNPPYIRKDVIPTLHTQVKDYEPYNALEGGEDGLDFYRSITEGSVKYLKKGGILA 252

Query: 225 VEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
            E+G++Q  DV  I ++     +   KD  G DRV++  +
Sbjct: 253 YEVGHDQAEDVSNIMKNCGYEKIYTKKDLPGIDRVVIGTK 292


>gi|158426117|ref|YP_001527409.1| modification methylase [Azorhizobium caulinodans ORS 571]
 gi|158333006|dbj|BAF90491.1| modification methylase [Azorhizobium caulinodans ORS 571]
          Length = 287

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 128/220 (58%), Gaps = 4/220 (1%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L    + R++G ++F+++  +LS +T  PRP+TE +V++AL   +   ++   + ILDLG
Sbjct: 70  LSGVPVARLVGEKEFWSLSFSLSPETLVPRPDTETVVEAAL---MTVTDRTAPLHILDLG 126

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+  ALL E P   G+GVD S  A   A+ N    G+  R   +  DW S++ G F
Sbjct: 127 TGSGAILAALLVELPAAVGIGVDQSEGAARTARDNLARAGLQGRGTVIVGDWASALGGGF 186

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D++VSNPPYI S+ +  L +EVR+ DP  +LDGG DGLS YR IA    R L   G   +
Sbjct: 187 DLVVSNPPYIPSIDIVGLAIEVRENDPLAALDGGADGLSSYRIIAAEAPRLLKAGGHLVL 246

Query: 226 EIGYNQKVDVVRIFESRKLFLVN-AFKDYGGNDRVLLFCR 264
           E+G  Q+ +V  +  +  L +   A +D GG  R L+  R
Sbjct: 247 ELGIGQEAEVAALAGAAGLAITGPARRDLGGIPRALVARR 286


>gi|307296978|ref|ZP_07576794.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sphingobium chlorophenolicum L-1]
 gi|306877504|gb|EFN08732.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sphingobium chlorophenolicum L-1]
          Length = 289

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 124/223 (55%), Gaps = 14/223 (6%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R L  E I  I G RDF+ + L ++ D   PRP++E L+++AL         R   RI
Sbjct: 71  LQRRLTGEPIAYITGTRDFWTISLHVTPDVLIPRPDSETLIEAALDH----FGARSPARI 126

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+GA+ LA L + P  +G GVDIS  AL +A+ NA   G  ER      +W   +
Sbjct: 127 LDLGTGSGALLLAALSQWPQARGTGVDISPAALAVAQDNADRLGFGERAAFRLGNWAEGI 186

Query: 162 EGLFDVIVSNPPYIE---SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
           EG FD+I+ NPPYI    ++  D L       +P  +L  G DGL  YR IA  + R L 
Sbjct: 187 EGPFDLILINPPYIARDVALAGDVL------HEPESALFAGADGLDDYRRIAPTLPRLLA 240

Query: 219 KDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            DG+ ++EIGY+Q++ V  +   + L  V + +D  G++R L+
Sbjct: 241 PDGMAAIEIGYDQRLSVSALLADQGLS-VASRRDLAGHERCLM 282


>gi|260589192|ref|ZP_05855105.1| protein-(glutamine-N5) methyltransferase [Blautia hansenii DSM
           20583]
 gi|331082608|ref|ZP_08331731.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260540273|gb|EEX20842.1| protein-(glutamine-N5) methyltransferase [Blautia hansenii DSM
           20583]
 gi|330400227|gb|EGG79869.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 285

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 140/255 (54%), Gaps = 6/255 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V+G+S     V  D  + +         I +  KH  + ++     FY ++ 
Sbjct: 26  DAWLLLEYVSGISRSWYFVHEDEEISENDIEEYQILIEQRGKHIPLQQLTKEAYFYGMKF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ +   PR +TE+LV+  L+ S    ++++ +++LD+ TG+G + LALL       G 
Sbjct: 86  FVNENVLIPRQDTEVLVEQVLSLS----KEKENLKLLDMCTGSGCILLALLANLKQASGT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD+S KALE+A+ N+   G+   +  +QSD F  V G +D+IVSNPPYIE+ +++ L  
Sbjct: 142 GVDLSEKALEVAQRNSKELGIEVSW--VQSDLFDKVSGSYDIIVSNPPYIETSVIEGLMD 199

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV+ ++PR++LDG  DGL  YR I     ++L  +G+ + EIGYNQ   V    +     
Sbjct: 200 EVKLYEPRMALDGTEDGLFFYREITMQAGKYLKNNGILAFEIGYNQGKAVSEFMKENGYK 259

Query: 246 LVNAFKDYGGNDRVL 260
            V   +D  G DRV+
Sbjct: 260 EVQVLQDLAGLDRVV 274


>gi|154502574|ref|ZP_02039634.1| hypothetical protein RUMGNA_00387 [Ruminococcus gnavus ATCC 29149]
 gi|153796766|gb|EDN79186.1| hypothetical protein RUMGNA_00387 [Ruminococcus gnavus ATCC 29149]
          Length = 283

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 142/258 (55%), Gaps = 6/258 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG++     ++P+  + D++       I +      +  + G ++F  +  
Sbjct: 25  DAWYLLEHVTGITKASYYMEPEHPMHDQEEREYLELIRKRSTRIPLQHLTGVQEFMGLEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SP-FFK 123
            ++     PR +TE+LV++AL   + + E+   +R+LD+ TG+G + L+LL E  P    
Sbjct: 85  LVNEHVLIPRQDTEVLVETAL--DVCKQEQMGEIRLLDMCTGSGCILLSLLHELKPRTVT 142

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
           GVGVD+S +AL +A+ NA    +   F  L+SD F +V+G +DV+VSNPPYI + +++ L
Sbjct: 143 GVGVDLSKEALCVAEKNAEKLKIDAEF--LESDLFENVKGTYDVVVSNPPYIRTSVIETL 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV+D DP ++LDG  DGL  YR I +    +L K G    EIG +Q  DV  + E   
Sbjct: 201 QEEVKDHDPYLALDGKEDGLYFYRRIIEQAPAYLKKKGWLLFEIGSDQGEDVKNLMEQAG 260

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V+  KD  G DRV+ 
Sbjct: 261 YTGVSVKKDLAGLDRVVF 278


>gi|225874212|ref|YP_002755671.1| ribosomal protein L11 methyltransferase [Acidobacterium capsulatum
           ATCC 51196]
 gi|225794369|gb|ACO34459.1| ribosomal protein L11 methyltransferase [Acidobacterium capsulatum
           ATCC 51196]
          Length = 294

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 85/238 (35%), Positives = 130/238 (54%), Gaps = 7/238 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L  V G +   +IV  D  +   Q     + I+R    E +  I+G ++F+ 
Sbjct: 36  ARRDAELLLQHVLGRNRAWLIVHSDDAMTAEQVTQFESWILRRAAQEPVQYIVGEQEFWG 95

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL ++ D   PRPETE LV++AL     R+ + + VR+ D+GTG+GA+ +AL    P  
Sbjct: 96  LRLRVTPDVLIPRPETEHLVEAALE----RLPEGETVRVADIGTGSGAIAIALAASRPQA 151

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
               +D+S  AL IA+ NA  +GV+ER   LQSD  ++V G  F +IVSNPPY+     +
Sbjct: 152 LVTALDLSEAALRIARENAAAHGVAERMRFLQSDLLAAVRGERFAMIVSNPPYVPG--GE 209

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
            L  +VRDF+P  +L  G +GL  YR +    +  L   G   +EIG+ Q+  +  + 
Sbjct: 210 ELEPQVRDFEPHSALFAGAEGLDVYRRLIPEAAEVLEPGGWLLMEIGHGQRAALAELL 267


>gi|158520490|ref|YP_001528360.1| HemK family modification methylase [Desulfococcus oleovorans Hxd3]
 gi|158509316|gb|ABW66283.1| modification methylase, HemK family [Desulfococcus oleovorans Hxd3]
          Length = 297

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 135/261 (51%), Gaps = 7/261 (2%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V G+    + +  D  L   +     + I R    E +  ILG + F+++ L ++ 
Sbjct: 36  LLAHVLGIKRLDLYLRYDQPLTPDELAAFRSLISRRKAGEPVAYILGEKAFWSMDLVVTP 95

Query: 70  DTFEPRPETELLVDSALAF-SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVD 128
           D   PRP+TE LV++AL+F + P  +      +L+  TG+GAV LAL K  P  +    D
Sbjct: 96  DVLIPRPDTECLVETALSFLAGPGSDTPAERWVLEPATGSGAVVLALAKSHPGCRFFAFD 155

Query: 129 ISCKALEIAKSNAVTNGVSERFDTLQSDWFS----SVEGLFDVIVSNPPYIESVIVDCLG 184
            S  AL +A+ NAV    + R     SDWFS    S  G FD+IV+NPPY+ S  +D L 
Sbjct: 156 RSTAALAVARKNAVRYDPAHRVVFFASDWFSALGNSASGRFDMIVANPPYVASGDIDHLA 215

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            E+  F+PR++LDGG DGL   R I     R L   G   +EIG++QK  V ++ E   L
Sbjct: 216 PEI-GFEPRMALDGGADGLDPVRHILQAAGRFLKPGGRLLIEIGWDQKERVAQVTEQAGL 274

Query: 245 FLVNAF-KDYGGNDRVLLFCR 264
           +    F KD  G+ RV+   R
Sbjct: 275 YTAVGFAKDLAGHHRVVHMQR 295


>gi|297182759|gb|ADI18913.1| methylase of polypeptide chain release factors [uncultured SAR11
           cluster bacterium HF0010_09O16]
          Length = 279

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 143/261 (54%), Gaps = 5/261 (1%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  DS   + +    +   +I++    +  R   +  N I      + I +I+  +DF
Sbjct: 20  ISAKLDSEILMSQAIRKNKKFIILNLHKEIKKRDLEYFDNLIQERAGRKPIAQIVKKKDF 79

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           +     ++++   PRP+TE L++  L      ++ ++ ++ILD+G G+G + +++LKE  
Sbjct: 80  WKYEFIVNNNVLIPRPDTETLIEQTLKL----VKNKNRLQILDIGIGSGCILMSILKEKK 135

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
            F G G+DIS K+L+I+K N     ++ R    +S+  +   G +D+IVSNPPYI+  I+
Sbjct: 136 NFIGTGIDISSKSLQISKVNGQKLRINNRLRLFKSNIDNFNTGKYDLIVSNPPYIKKSIL 195

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
            CL  ++  F+P+ +LDGG+DGLS  R + +  S  + + G   +EIG++QK  V +I  
Sbjct: 196 KCLEKDI-GFEPKQALDGGLDGLSEIRKVINKSSELIKRSGHLIIEIGFDQKNKVKKILR 254

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
            +  ++    KD   +DR ++
Sbjct: 255 DKGFYIKKTVKDLSNHDRCIV 275


>gi|254461332|ref|ZP_05074748.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacterales bacterium HTCC2083]
 gi|206677921|gb|EDZ42408.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 278

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 137/257 (53%), Gaps = 7/257 (2%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           +RD       V+ + + ++ +     + ++QR      + R + +  I +I+  R F+  
Sbjct: 23  MRDLRILAAHVSQVDASRMTLHMHDEVTEKQREHFKLLVNRRMSNMPISKIIQKRLFWGR 82

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +  +  +PR +TE L+ + L     ++  +D  ++LDLGTG+GA+ L L  E P   
Sbjct: 83  EFEVDLNVLDPRGDTETLIAACL-----KLGPQD--KVLDLGTGSGAIGLTLTAEWPLAD 135

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
            +  DIS +AL++A+ N  +  V++    L+SDWF +VEG FD+IVSNPPYI     D L
Sbjct: 136 VMCTDISDEALDVARLNMKSFDVADGVRLLRSDWFEAVEGRFDLIVSNPPYIALEEWDGL 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR FDPR++L    DGLS YR I      +L KDG   VEIG+ Q  DV  ++ +  
Sbjct: 196 DFEVRGFDPRMALTDEADGLSCYRVIVAQAGAYLEKDGHLMVEIGHAQGRDVQDLYAAAG 255

Query: 244 LFLVNAFKDYGGNDRVL 260
              +    D  G DRV+
Sbjct: 256 FTQITCLPDLAGRDRVV 272


>gi|88861345|ref|ZP_01135975.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas tunicata D2]
 gi|88816611|gb|EAR26436.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas tunicata D2]
          Length = 281

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 135/258 (52%), Gaps = 10/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V G S   +   PD  L  +Q+     A+ R L  E I  I+G+R+F++++L
Sbjct: 27  DAQVLLLDVIGQSRSYLFTWPDKALTAQQQTQFEQAVARRLAGEPIAHIIGYREFWSLKL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL+ +LP     +  ++LDLGTGTGA+ LAL  E   ++  
Sbjct: 87  KVSPATLIPRPDTETLVEHALSLALP-----EHAKVLDLGTGTGAIALALASEQFNWQVT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           G D    A+ +A++N     +   RF  +QS+WFS+     FD+IVSNPPYIE       
Sbjct: 142 GCDRIEDAVVLAQTNQAALEIKNCRF--VQSNWFSAFSTEQFDLIVSNPPYIEQDDPHLS 199

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  RTI +     L   G   +E GY Q   V  IF    
Sbjct: 200 QGDVR-FEPLSALVAPDNGLADIRTIVNQARTFLTSGGYLLLEHGYQQAEQVSAIFLQMA 258

Query: 244 LFLVNAFKDYGGNDRVLL 261
              +   KD  GNDRV L
Sbjct: 259 YKDIRTIKDLAGNDRVTL 276


>gi|210608517|ref|ZP_03287893.1| hypothetical protein CLONEX_00072 [Clostridium nexile DSM 1787]
 gi|210153008|gb|EEA84014.1| hypothetical protein CLONEX_00072 [Clostridium nexile DSM 1787]
          Length = 287

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 135/256 (52%), Gaps = 8/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTGL      + PD  + D Q       + +  +H  +  I G ++F  +  
Sbjct: 25  DAWYLLEFVTGLDRTAYFLKPDEKITDEQGSLYKAYLEQRAQHIPLQHITGVQEFMGLEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PR +TE LV+  L++  P++      ++LD+ TG+G + ++L+K     +GV
Sbjct: 85  AVNEHVLVPRQDTETLVECVLSYVQPQM------KVLDMCTGSGCILISLMKLGKIAQGV 138

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G DIS +AL+ AK NA  + V      ++SD F ++   +DVIVSNPPYI + +++ L  
Sbjct: 139 GADISDEALKTAKKNAEKHQVEPLL--IKSDLFENIVDKYDVIVSNPPYIRTAVIEELKE 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EVR  DP ++LDG  DGL  YR + +    +L K G+   EIG++Q  DV  + E     
Sbjct: 197 EVRCHDPILALDGKEDGLYFYRKLIEQSPMYLKKGGMLYFEIGHDQGQDVKCLMEKAGFE 256

Query: 246 LVNAFKDYGGNDRVLL 261
            V   KD  G DRV+ 
Sbjct: 257 DVMVKKDLAGLDRVVF 272


>gi|150388170|ref|YP_001318219.1| HemK family modification methylase [Alkaliphilus metalliredigens
           QYMF]
 gi|149948032|gb|ABR46560.1| modification methylase, HemK family [Alkaliphilus metalliredigens
           QYMF]
          Length = 293

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 135/261 (51%), Gaps = 6/261 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC +      Q+ + P+  +D+  +      I +  K   +  I+G ++F  +  
Sbjct: 26  DAEVILCHLLKTERIQLHIYPERKVDEEVQEQFWEGIQKRKKRMPVQYIVGTQEFMGLDF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            + S    PR +TE+LV+S L          + V ++D+GTG+GA+ ++L +     K  
Sbjct: 86  RVESGVLIPRADTEILVESVLGLYEVHY-NNEAVALMDIGTGSGAIAISLARFIERSKIY 144

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-----EGLFDVIVSNPPYIESVIV 180
            +D+S KALEIA++N  TN V  +        F  +     EG F  ++SNPPYI   +V
Sbjct: 145 AIDLSEKALEIAENNGRTNEVQHKISFFYGSLFEPLKGYDLEGTFQFVISNPPYIPPDVV 204

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           + L  +V+D++PR++L+GG DGL  YR I +   ++L   G    EIGY+Q   V  + E
Sbjct: 205 EELSPQVKDYEPRMALEGGADGLDFYREIVEKAPQYLQMKGWLCFEIGYDQGEQVKGLME 264

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
           +R    V   +D  G DRV++
Sbjct: 265 TRGFSRVEVIRDLAGLDRVVI 285


>gi|332558341|ref|ZP_08412663.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Rhodobacter sphaeroides WS8N]
 gi|332276053|gb|EGJ21368.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Rhodobacter sphaeroides WS8N]
          Length = 278

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 131/259 (50%), Gaps = 8/259 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A RD+   L     +   ++ +     L          A+      + + +I+G R F+
Sbjct: 21  EAARDARRLLAHAMAIDPARLTLHLPDPLPPEAAARFEAALAARAARQPVGQIVGERLFW 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
             R  ++ DT +PRPETE L+D+ALA             +LDLGTGTG + + LL E P 
Sbjct: 81  GRRFRVTRDTLDPRPETEGLIDAALAEPF--------ATVLDLGTGTGCIAVTLLAERPA 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G+  D+S  AL +A  NA   GV+ R +   SDWF++V    D+I+SNPPYI +  + 
Sbjct: 133 AHGIATDLSPAALAVAAENAAALGVAPRLELRLSDWFAAVPERVDLILSNPPYIAADEMA 192

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++L  G DGL  YR IA G   HL   G   +EIG  Q   V  + E+
Sbjct: 193 ALAPEVRLWEPHLALSPGGDGLDAYRAIARGAPAHLRPGGRLLLEIGAAQGRAVAGLVEA 252

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V+   D  G DR++
Sbjct: 253 AGLARVSVLPDLDGRDRLV 271


>gi|254450152|ref|ZP_05063589.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Octadecabacter antarcticus 238]
 gi|198264558|gb|EDY88828.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Octadecabacter antarcticus 238]
          Length = 268

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 127/235 (54%), Gaps = 10/235 (4%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D   D  +  F  +   R+ +    H +LG+RDFY  R  ++ D  +PR +TE L+++AL
Sbjct: 39  DEFEDAPEAAFFADIGQRAARTPVSH-LLGYRDFYGRRFQVTPDVLDPRGDTETLIEAAL 97

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
           A             +LDLGTG+G + + LL E     G+GVD+S +A+ +A+ NA+  GV
Sbjct: 98  AVPF--------ADVLDLGTGSGCILVTLLAERGAVTGIGVDVSPRAVTVAEQNALRLGV 149

Query: 147 SERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHY 206
            +R     SDWF  V   FD+IVSNPPYI    +  L  E+  ++PR++L    DGL+ Y
Sbjct: 150 QDRCAFAVSDWFKGVGVPFDLIVSNPPYIALDEMAGLAPEL-GYEPRLALTDEGDGLAAY 208

Query: 207 RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           R I  G + HL + G   VEIG  Q   V+ +FE   L  V    D  G DRV++
Sbjct: 209 REITAGAAGHLRQGGWLMVEIGPTQGGAVIALFEVAGLEQVGIRVDLDGRDRVVV 263


>gi|221639322|ref|YP_002525584.1| Modification methylase, HemK family [Rhodobacter sphaeroides KD131]
 gi|221160103|gb|ACM01083.1| Modification methylase, HemK family [Rhodobacter sphaeroides KD131]
          Length = 278

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 132/259 (50%), Gaps = 8/259 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A RD+   L     +   ++ +     L          A+   +  + + +I+G R F+
Sbjct: 21  EAARDARRLLAHAMAIDPARLTLHLPDPLPPEAAARFEAALAARVARQPVGQIVGERLFW 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
             R  ++ DT +PRPETE L+++ALA             +LDLGTGTG + + LL E P 
Sbjct: 81  GRRFRVTRDTLDPRPETEGLIEAALAEPF--------ATVLDLGTGTGCIAVTLLAERPA 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G+  D+S  AL +A  NA   GV+ R +   SDWF++V    D+I+SNPPYI +  + 
Sbjct: 133 AHGIATDLSPAALAVAAENAAALGVAPRLELRLSDWFAAVPERVDLILSNPPYIAADEMA 192

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++L  G DGL  YR IA G   HL   G   +EIG  Q   V  + E+
Sbjct: 193 ALAPEVRLWEPHLALSPGGDGLDAYRAIARGAPAHLRPGGRLLLEIGAAQGRAVAGLVEA 252

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V+   D  G DR++
Sbjct: 253 AGLAQVSVLPDLDGRDRLV 271


>gi|103488190|ref|YP_617751.1| HemK family modification methylase [Sphingopyxis alaskensis RB2256]
 gi|98978267|gb|ABF54418.1| modification methylase, HemK family [Sphingopyxis alaskensis
           RB2256]
          Length = 274

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 139/262 (53%), Gaps = 18/262 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIV-RSLKHESIHRILGWRDFYNVR 64
           D+   +    G+    +++DP +  D    F   +A+V R + HE +  ILG+RDF+ +R
Sbjct: 25  DAELLMADALGIERQALLLDP-ARYDVPADF---DALVERRMAHEPVAYILGYRDFWTIR 80

Query: 65  LTLSSDTFEPRPETELLVDSAL---AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
           L +      PRP++E L+ +A+     + PR        ILDLGTG G +  A + E   
Sbjct: 81  LAVGPGALIPRPDSETLIAAAVQHFGAAGPR-------HILDLGTGPGTLLFAAMSEWAD 133

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
            +G+GVD S  AL  A++NA+  G+++R   +Q DW + V G FD+I+ NPPYI     +
Sbjct: 134 ARGLGVDASDVALGYARANAIALGLADRVGLMQGDWAAGVTGRFDLILCNPPYIAE--SE 191

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  +V D +P  +L  G DGL+ YR I   +   L   G+  +EIG+ Q++ V  + ++
Sbjct: 192 ALMPDVADHEPAGALFAGADGLADYRRIIPDLPHLLAPGGIAILEIGHTQRISVSEMADA 251

Query: 242 RKLFLVNAFKDYGGNDRVLLFC 263
              F V   +D  G DR LL  
Sbjct: 252 AG-FAVACRQDLAGRDRALLLT 272


>gi|109898877|ref|YP_662132.1| HemK family modification methylase [Pseudoalteromonas atlantica
           T6c]
 gi|109701158|gb|ABG41078.1| [protein release factor]-glutamine N5-methyltransferase
           [Pseudoalteromonas atlantica T6c]
          Length = 298

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 139/273 (50%), Gaps = 20/273 (7%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  DS   +C V    +  ++  P+  LD+ Q       + +      I  +LG+RDF++
Sbjct: 30  AALDSRLLMCHVLQCETAYLMTWPEKPLDELQLRTYQQLVAKRKTGYPIAYLLGYRDFWS 89

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL +S  T  PRPETELLV++ L  +LP  E      +LDLGTGTGA+ LAL  E P +
Sbjct: 90  LRLRVSPATLIPRPETELLVETVL--NLPIAED---AHVLDLGTGTGAIALALASEKPNW 144

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-----------GLFDVIVS 170
           + +G+D S  A+ +AK NA  N + + RF  +QSDWFS++E            +F +IVS
Sbjct: 145 QVLGIDKSADAVALAKQNAELNSLPQVRF--MQSDWFSALEQTQLDQQNNQHNVFSLIVS 202

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPY+E   V     +VR F+P  +L  G DGL   R I       L   G  + E GY 
Sbjct: 203 NPPYVEDDSVYLQQGDVR-FEPASALTSGKDGLDDIRIIISKAITFLPSGGWLAFEHGYQ 261

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           Q   V  +  +     V++  D     R+ L C
Sbjct: 262 QAQGVQALLVNNGFEQVHSVNDLNDLPRITLGC 294


>gi|251792739|ref|YP_003007465.1| protein-(glutamine-N5) methyltransferase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534132|gb|ACS97378.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Aggregatibacter aphrophilus NJ8700]
          Length = 299

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/268 (35%), Positives = 146/268 (54%), Gaps = 15/268 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L   T  S   ++   ++VL+ +    LT  + R LK E I  +LG ++F+++ L
Sbjct: 26  DALVLLQSATQKSRAFILAFGETVLEKKTLEKLTALLSRRLKGEPIAYLLGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV----VRILDLGTGTGAVCLALLKESPF 121
            +S  T  PRP+TE+LV+ A+  ++ +++K D      RILDLGTGTGA+ LAL  E  F
Sbjct: 86  AVSEKTLIPRPDTEVLVEKAVEIAIEKLQKCDQHSPSFRILDLGTGTGAIALALASELKF 145

Query: 122 FKG--------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
                      +GVD   + +E+A++NA  N ++  F  LQS WF +V G FDVIVSNPP
Sbjct: 146 VAQKQQIQLDIIGVDFLPEIVELARTNAKKNQLNVHF--LQSHWFDNVRGQFDVIVSNPP 203

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI++        +VR F+P  +L     G +  R I +   ++L ++G   +E G+ Q  
Sbjct: 204 YIDNNDEHLNQGDVR-FEPLSALVAEEGGYTDLRHIIEHAPQYLTENGYLLLEHGWQQGE 262

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            V  IF+      V   +DYG N+RV L
Sbjct: 263 KVRSIFQMNLWQDVETCRDYGNNERVTL 290


>gi|123442666|ref|YP_001006643.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122089627|emb|CAL12477.1| putative protoporphyrinogen oxidase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 284

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 136/257 (52%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q   L     R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLSFVTGRARSYLLAFGETQLTAEQLAVLEPLAARREQGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P    
Sbjct: 82  LSVSSATLIPRPDTECLVEQALAH-LPVTP----CRILDLGTGTGAIALALASERPDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +GVDI   A+ +A+ NA    ++   D LQS WF SV G F +IVSNPPYI++       
Sbjct: 137 MGVDIKADAVALARHNAKKLAIN-NVDFLQSSWFDSVSGRFTLIVSNPPYIDANDPHLNE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L   G   +E G+ Q   V ++  +   
Sbjct: 196 GDVR-YEPHSALVAEAEGIADLAEIIRQSPAYLEVGGWLMLEHGWQQATAVQKLLNNSGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V  +KDYG NDRV L
Sbjct: 255 SAVMTYKDYGNNDRVTL 271


>gi|254362306|ref|ZP_04978418.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           PHL213]
 gi|153093886|gb|EDN74814.1| protein-glutamine N-methyltransferase [Mannheimia haemolytica
           PHL213]
          Length = 288

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 142/256 (55%), Gaps = 4/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    +++L + +   L   + R  K E +  ILG+R+F+++ L
Sbjct: 29  DANLLLQAVTKRSKSAIFAFSETLLSESELAELAEKLARRAKGEPMAYILGYREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-SPFFKG 124
            +S  T  PRP+TE LV+ AL ++  R+  + +++ILDLGTGTGA+ LAL  E     + 
Sbjct: 89  KVSPATLIPRPDTERLVELALEYANKRLGNQKMLQILDLGTGTGAIALALASELGEKAQI 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           +GVD   +A+++A+ N    G+++    LQSDWFSS+    FD+IVSNPPYI+    +  
Sbjct: 149 IGVDFQNEAVQLAEENRRNLGLNQ-VTFLQSDWFSSLANQQFDLIVSNPPYIDESDENLT 207

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GLS  + I +    HL   G   +E G+ Q   V  +F+   
Sbjct: 208 VGDVR-FEPLTALVADNKGLSDLQKIIENAPLHLKPQGALMLEHGWKQGNLVRDLFDLHL 266

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DY GNDRV
Sbjct: 267 WEQVETAQDYAGNDRV 282


>gi|307942490|ref|ZP_07657839.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseibium sp. TrichSKD4]
 gi|307774311|gb|EFO33523.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseibium sp. TrichSKD4]
          Length = 280

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 117/212 (55%), Gaps = 6/212 (2%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV-RILDLGTGTG 109
           + RILG R+FY +   L++DT EPRP+TE+LVD+ L      I   D   R LD+GTGTG
Sbjct: 70  VGRILGVREFYGLEFQLNADTLEPRPDTEILVDTVL-----NIAPTDTAWRFLDVGTGTG 124

Query: 110 AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIV 169
           A+ +AL   S   +G   DIS  AL  AK+NA  NGV  R   ++  + +   G FD IV
Sbjct: 125 AIAIALAANSALAEGAASDISEHALLAAKANAAMNGVEGRLSFVRGSYLAPFSGQFDWIV 184

Query: 170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY 229
           SNPPYI S +V  L   VR +DP  +LDGG DGL  YR +       L   G  ++EIG+
Sbjct: 185 SNPPYIASDVVRQLDTGVRAYDPLRALDGGADGLDAYRQLIPSAKELLAPSGHLALEIGF 244

Query: 230 NQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           +Q   V  +        V   KD  G DRV+L
Sbjct: 245 DQGKSVSSLCTDHGYCGVEIIKDLAGQDRVVL 276


>gi|118581410|ref|YP_902660.1| HemK family modification methylase [Pelobacter propionicus DSM
           2379]
 gi|118504120|gb|ABL00603.1| [protein release factor]-glutamine N5-methyltransferase [Pelobacter
           propionicus DSM 2379]
          Length = 288

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 134/262 (51%), Gaps = 12/262 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   LC  TGL    + ++ D  L+  +       + R  + E +  ILG ++F  +  
Sbjct: 31  EAEWLLCAATGLDRVGLYLNYDKPLNREELSAFRQMVARRARREPLQHILGSQEFCGLEF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR-ILDLGTGTGAVCLALLKESPFFKG 124
            +S D   PR +TE LV+ AL        +  + R +LD+GTG+G + ++L +  P  + 
Sbjct: 91  AVSPDVLIPRHDTETLVEEAL-------RRAPLARTVLDIGTGSGCIAVSLARRLPGARI 143

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
           V  DIS  ALE+A++NA  NGV   F  L       V G  FD+IVSNPPYI S  +  L
Sbjct: 144 VASDISAVALEMARANARANGVDVEF--LHGSLLEPVAGRCFDLIVSNPPYIPSADIQLL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVRD DPR++LDGG DGL  YR +      HL   G   +E+G  Q  DV  +F    
Sbjct: 202 EPEVRDGDPRLALDGGPDGLDIYRRLIPASLEHLEPGGWLLLEVGMGQAQDVAEMFPLAD 261

Query: 244 LF-LVNAFKDYGGNDRVLLFCR 264
            +  V +  D GG +RV+   R
Sbjct: 262 GYGQVVSSPDPGGIERVVGAAR 283


>gi|157826325|ref|YP_001494045.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia akari str. Hartford]
 gi|157800283|gb|ABV75537.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia akari str. Hartford]
          Length = 522

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 134/258 (51%), Gaps = 19/258 (7%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L + +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLSEAEIKAFEKLLERRLKHEPITYITGVKEFYSREFIVNKHVLIPRSDTEIL 102

Query: 82  VDSALA------------FSLPRIEKRDVV------RILDLGTGTGAVCLALLKESPFFK 123
           VD  L                P  +K D V       IL+LGTG+G V ++LL E P   
Sbjct: 103 VDVVLQRYSHSTQGHSTESGKPETKKLDSVVNPRNDSILELGTGSGCVAISLLCELPNAN 162

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDC 182
            +  DIS +A+E+AKSNA+ + V++R   + SDWF ++ +  FDVIVSNPPYI       
Sbjct: 163 IIATDISIEAIEVAKSNAIKHHVTDRIQIIHSDWFENLGKQKFDVIVSNPPYISHSEKSE 222

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           + LE  + +P  +L    DGL  YR IA      L  +G   +EIG+NQ   V +IF + 
Sbjct: 223 MALETLNHEPHFALFAEEDGLQAYRIIAKNAKPFLKPNGKIILEIGFNQAEKVSKIFLNY 282

Query: 243 KLFLVNAFKDYGGNDRVL 260
              + N +KD   ++RV+
Sbjct: 283 GYNIDNIYKDLQSHNRVI 300


>gi|227824240|ref|ZP_03989072.1| modification methylase [Acidaminococcus sp. D21]
 gi|226904739|gb|EEH90657.1| modification methylase [Acidaminococcus sp. D21]
          Length = 298

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 137/261 (52%), Gaps = 8/261 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G+    +    D  L+  +       ++R  K E +  ILG + F +   
Sbjct: 30  DAELLLCAVLGMRRIDLYTHFDQPLEKEELAAYRGYVMRRAKREPVAYILGEKGFLDYTF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +++DT  PRPETELLV+  LA     +     + IL+LG G+GA+ ++LL +    +G+
Sbjct: 90  AVTADTLIPRPETELLVEKILA-----VTADGPLDILELGVGSGAILISLLLKRKEAQGL 144

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EG-LFDVIVSNPPYIESVIVDCL 183
           GVDIS  A+ +A+ NA   GV++R + + SD F  V EG  FD+IVSNPPYI    +  L
Sbjct: 145 GVDISEGAVAVARKNAKNLGVTDRSEIIVSDLFEKVPEGRKFDLIVSNPPYIPKKDLAGL 204

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EVR  +P  +LDGG DGL  YR I      +L +DGL + E+G  +      +     
Sbjct: 205 SPEVRK-EPLGALDGGEDGLDFYRRIVREGMAYLKEDGLFAFEVGIGEGAAAADLLVQNG 263

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
                 F DY G DR++L  +
Sbjct: 264 CGAARVFLDYAGIDRMVLAAK 284


>gi|297182949|gb|ADI19097.1| methylase of polypeptide chain release factors [uncultured alpha
           proteobacterium HF0070_34A12]
          Length = 247

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 118/205 (57%), Gaps = 8/205 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L    GL    +  +  +  DD         + R L  E + RI GWR+F+ +RL
Sbjct: 30  DSRLLLGTALGLDRAVLPHETLAGFDDAAAAMFEAFLNRRLGGEPVSRIRGWREFWTLRL 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L+  T +PRP++E +V +ALA + P        R+LDLG GTGA+ LA L E P   G 
Sbjct: 90  ELAPATLDPRPDSETIVAAALAATDPG----KPCRMLDLGCGTGALLLACLSERPDATGT 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS---VEGLFDVIVSNPPYIESVIVDC 182
           GVDI+ +A+E+A  NA  NG+S R D +  D FS      G++D+I+ NPPYI +  +D 
Sbjct: 146 GVDIAGEAVEVATRNAGKNGLSARADFVIGD-FSDPDVAPGIYDLILCNPPYIPAGEIDG 204

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYR 207
           L +EV  FDPR++LDGG DGL  +R
Sbjct: 205 LAVEVACFDPRLALDGGDDGLDCWR 229


>gi|320109110|ref|YP_004184700.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Terriglobus saanensis SP1PR4]
 gi|319927631|gb|ADV84706.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Terriglobus saanensis SP1PR4]
          Length = 286

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 124/227 (54%), Gaps = 5/227 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A+RDSH  L    G+S  Q++  P+ +L  RQ     + +   L+   I  + G ++FY 
Sbjct: 30  AVRDSHLLLQHALGVSREQIMAWPERMLTPRQSAAFEHLVSERLRAVPIQYLRGQQEFYG 89

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               ++ D   PRPETEL++D    +    I+   +V I D+G+G+GA+ + L  E    
Sbjct: 90  RNFLVTPDVLIPRPETELIIDEVKRY----IDPSALVMIADIGSGSGAIGVTLAAEFEMA 145

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVD 181
           +    D+S  AL + + NA+ + VS+R  T +SD FS++ E +FD +VSNPPYI +   D
Sbjct: 146 RITAADLSPAALAVTEQNAIRHHVSDRVRTFESDLFSALGERIFDYVVSNPPYIAASERD 205

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG 228
            L  +VRD +P ++L GG DG   Y  +     +HL   G+  +EIG
Sbjct: 206 SLHPQVRDHEPELALYGGEDGFEIYTRLIPQAWKHLRPGGMLFLEIG 252


>gi|254440594|ref|ZP_05054088.1| methyltransferase, HemK family [Octadecabacter antarcticus 307]
 gi|198256040|gb|EDY80354.1| methyltransferase, HemK family [Octadecabacter antarcticus 307]
          Length = 272

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 120/220 (54%), Gaps = 9/220 (4%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R    E +  + G RDFY  R  +  D  +PRP+TE LV +AL        +R   R+
Sbjct: 57  VARRAAREPMSHLTGGRDFYEHRFEVGPDVLDPRPDTESLVIAAL--------ERPFDRV 108

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+G V L+LL   P  +GVG D+S  AL +A  NA    +  R D + SDW++S+
Sbjct: 109 LDLGTGSGCVLLSLLAARPDARGVGSDVSAAALVVAARNAAKLEIDHRVDLIVSDWYASI 168

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G FD+IVSNPPY+    +  L  E+  ++PRI+L  G DGL  YR I  G   HL   G
Sbjct: 169 YGQFDLIVSNPPYLALAEMASLAPEL-SYEPRIALTDGGDGLGCYRVITAGAGEHLTAGG 227

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
              VEIG +Q   VV +F +  L  V    D    DRV+L
Sbjct: 228 WLMVEIGPSQGAAVVAMFGAAGLVCVQIRHDLDARDRVVL 267


>gi|255994692|ref|ZP_05427827.1| protein-(glutamine-N5) methyltransferase [Eubacterium saphenum ATCC
           49989]
 gi|255993405|gb|EEU03494.1| protein-(glutamine-N5) methyltransferase [Eubacterium saphenum ATCC
           49989]
          Length = 307

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 136/264 (51%), Gaps = 16/264 (6%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQ----------RFFLTNAIVRSLKHESIHRILGWRD 59
             C   G+S  ++++     L  RQ          R +  + I R LK + +  ILG  +
Sbjct: 41  LFCFAAGISKSELLLRQSRALSPRQGRSAFGEDVYRKY-DSIIARRLKRKPLQHILGSVN 99

Query: 60  FYNVRLTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRD-VVRILDLGTGTGAVCLALLK 117
           F+     +      PR ETELLV+  L    + + E R+  +++LDL TGTG + + + K
Sbjct: 100 FFGFDFKVDERALIPRFETELLVEKTLEKIEVLQNETREKSIKVLDLCTGTGVIGITVKK 159

Query: 118 ESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS-VEGLFDVIVSNPPYIE 176
             P  +    DIS  ALE+A  N+ +     R   +QSD F    +  FD+IVSNPPYI 
Sbjct: 160 TIPDVECTLSDISSDALELAADNSKSLKADVRI--VQSDLFEEFADEKFDIIVSNPPYIR 217

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
              +D L LEVR+FDP ++LDGG DGL  YR IAD V  +L + G    EIG +Q  DVV
Sbjct: 218 RADIDKLQLEVREFDPHLALDGGEDGLELYRNIADEVQNYLKRSGYLICEIGADQGDDVV 277

Query: 237 RIFESRKLFLVNAFKDYGGNDRVL 260
           +IF+          KD+   DR+L
Sbjct: 278 KIFKEAGAVNARIIKDFTDKDRIL 301


>gi|77463464|ref|YP_352968.1| putative methylase [Rhodobacter sphaeroides 2.4.1]
 gi|77387882|gb|ABA79067.1| Putative methylase [Rhodobacter sphaeroides 2.4.1]
          Length = 278

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 131/259 (50%), Gaps = 8/259 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A RD+   L     +   ++ +     L          A+      + + +I+G R F+
Sbjct: 21  EAARDARRLLAHAMAIDPARLTLHLPDPLPPEAAARFEAALAARAARQPVGQIVGERLFW 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
             R  ++ DT +PRPETE L+++ALA             +LDLGTGTG + + LL E P 
Sbjct: 81  GRRFRVTRDTLDPRPETEGLIEAALAEPF--------ATVLDLGTGTGCIAVTLLAERPA 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G+  D+S  AL +A  NA   GV+ R +   SDWF++V    D+I+SNPPYI +  + 
Sbjct: 133 AHGIATDLSPAALAVAAENAAALGVASRLELRLSDWFAAVPERVDLILSNPPYIAADEMA 192

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++L  G DGL  YR IA G   HL   G   +EIG  Q   V  + E+
Sbjct: 193 ALAPEVRLWEPHLALSPGGDGLDAYRAIARGAPAHLRPGGRLLLEIGAAQGRAVAGLVEA 252

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V+   D  G DR++
Sbjct: 253 AGLARVSVLPDLDGRDRLV 271


>gi|157964997|ref|YP_001499821.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia massiliae MTU5]
 gi|157844773|gb|ABV85274.1| Methylase of polypeptide chain release factors [Rickettsia
           massiliae MTU5]
          Length = 511

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 133/251 (52%), Gaps = 10/251 (3%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAEIEAFEKLLERRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSALAFSLPRIEKRDV--------VRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           VD       PR    D+        + IL+LGTG+G + ++LL E P    +  DIS  A
Sbjct: 103 VDVVFQCH-PRFRGDDISENCNDKFLNILELGTGSGCIAISLLCELPNANVIATDISLDA 161

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDP 192
           +EI KSNA    V++R   + S+WF ++E   FD IVSNPPYI       + +E  +++P
Sbjct: 162 IEIIKSNAAKYSVTDRIQIIHSNWFENIETQKFDFIVSNPPYIAHSEKSEMAIETINYEP 221

Query: 193 RISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKD 252
            I+L    DGL  Y  IA+   + L  +G   +EIG+ Q+  V +IF      + + +KD
Sbjct: 222 SIALFAEKDGLHAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFLDHGYNIESVYKD 281

Query: 253 YGGNDRVLLFC 263
             G+ RV+LF 
Sbjct: 282 LQGHSRVILFT 292


>gi|125974913|ref|YP_001038823.1| HemK family modification methylase [Clostridium thermocellum ATCC
           27405]
 gi|256003830|ref|ZP_05428817.1| modification methylase, HemK family [Clostridium thermocellum DSM
           2360]
 gi|281418621|ref|ZP_06249640.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium thermocellum JW20]
 gi|125715138|gb|ABN53630.1| modification methylase, HemK family [Clostridium thermocellum ATCC
           27405]
 gi|255992168|gb|EEU02263.1| modification methylase, HemK family [Clostridium thermocellum DSM
           2360]
 gi|281407705|gb|EFB37964.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium thermocellum JW20]
 gi|316939124|gb|ADU73158.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium thermocellum DSM 1313]
          Length = 302

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 143/275 (52%), Gaps = 26/275 (9%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            LCRV  +    +    D  + + +    T  +   +K + +  I G ++F ++   ++ 
Sbjct: 29  LLCRVLNVDRSYLYSHDDYNMTEEEYKKFTLFLEERIKGKPLQYITGHQEFMSLDFIVTP 88

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLAL---LKESPFFKGVG 126
           D   PR +TE LV++ L     +    +  RILD+GTG+G + ++L   LK+S   + + 
Sbjct: 89  DVLIPRQDTETLVEAVLTHV--KSTGLENARILDIGTGSGCIAVSLAHFLKDS---RVLA 143

Query: 127 VDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-----------------EGLFDVIV 169
           +DIS KALEIA++NA   GV +R   L+ D    +                 EG FD+IV
Sbjct: 144 LDISEKALEIAETNAKRCGVWDRMFFLKGDALEGLAGIIAQSPFAKDFERKGEGFFDIIV 203

Query: 170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY 229
           SNPPYI S  +  L  +V+D++PR +LDGGIDGL  YR I    ++ L+ D L + E+GY
Sbjct: 204 SNPPYIPSEEIKTLHKQVKDYEPRTALDGGIDGLDFYRAITCEAAKLLSTDSLLAFEVGY 263

Query: 230 NQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
           NQ  +V   F       +   KD  G DRV++ CR
Sbjct: 264 NQAENVSE-FMKESFSAIKVVKDLAGIDRVVMGCR 297


>gi|237745911|ref|ZP_04576391.1| methyltransferase HemK MTase hemK [Oxalobacter formigenes HOxBLS]
 gi|229377262|gb|EEO27353.1| methyltransferase HemK MTase hemK [Oxalobacter formigenes HOxBLS]
          Length = 287

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 137/255 (53%), Gaps = 14/255 (5%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L    G S  ++I   D VL D +   +++ + R L+ E +  I G R+FY +   ++ 
Sbjct: 35  LLEHALGFSRVKLITHSDHVLTDAEANAVSDVLARRLRGEPVAYITGIREFYGLPFAVTP 94

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRPETELLVD ALA  LP     +  R++DLGTG+GA+ +A+    P  +    DI
Sbjct: 95  DVLIPRPETELLVDLALA-RLP-----EGGRVVDLGTGSGAIAVAIAAMRPDAQVWATDI 148

Query: 130 SCKALEIAKSNAVT---NGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCLG 184
           S KAL+IA+ NA +   NG S RF   Q +W+ ++E    FD+IVSNPPYI S       
Sbjct: 149 SGKALDIARKNAASCLKNGQSVRFR--QGNWYEALEPGSRFDLIVSNPPYIHSADEHLRK 206

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            ++R F+P  +L    DGLS    + D    +L K G   +E GYNQ   V +    +K 
Sbjct: 207 GDLR-FEPLSALTDYTDGLSAMDILIDQAPAYLKKGGELLMEHGYNQSGAVRKKLVDKKY 265

Query: 245 FLVNAFKDYGGNDRV 259
             V ++KD  G +RV
Sbjct: 266 LQVQSWKDLAGIERV 280


>gi|160878571|ref|YP_001557539.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium phytofermentans ISDg]
 gi|160427237|gb|ABX40800.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium phytofermentans ISDg]
          Length = 279

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 92/257 (35%), Positives = 136/257 (52%), Gaps = 13/257 (5%)

Query: 6   DSHSFLCRVTGLS--SHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L  VTGL    + +    D  ++  +R+     + +   H  +  + G ++F  +
Sbjct: 28  DAWYLLEHVTGLRRIDYMIRAKEDMSIEVYERY--QQLLKKRALHIPLQYLTGSQEFMGL 85

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++     PR +TE LV+  L  S    + +DV   L+L TG+G + ++L K      
Sbjct: 86  SFRVNESVLIPRQDTERLVEEVLKVS----KDKDV---LELCTGSGCIIISLAKLGNIKN 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
            V VDIS  A+++AK NA  N V   +  L SD FS+V G +DVIVSNPPYIES +++ L
Sbjct: 139 AVAVDISSDAIKVAKENAKDNEVLVTY--LLSDMFSNVSGTYDVIVSNPPYIESEVIEGL 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV+D +PRI+LDG  DGL  YR +A    R LNK+G   +EIG NQ   +  +     
Sbjct: 197 MPEVKDHEPRIALDGDADGLKFYRILAKESGRFLNKNGRLYLEIGCNQAAFIGELLSQNG 256

Query: 244 LFLVNAFKDYGGNDRVL 260
              +   KDY G DRV+
Sbjct: 257 FAQIKVVKDYAGLDRVV 273


>gi|315651890|ref|ZP_07904893.1| protein-(glutamine-N5) methyltransferase [Eubacterium saburreum DSM
           3986]
 gi|315485892|gb|EFU76271.1| protein-(glutamine-N5) methyltransferase [Eubacterium saburreum DSM
           3986]
          Length = 281

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 138/236 (58%), Gaps = 14/236 (5%)

Query: 30  LDDRQRF-FLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF 88
           + DR++   L + + + L++  I  IL    F      +      PR +TE+LV+  L  
Sbjct: 49  IKDREKLDILESYVSKRLENMPIQYILNKAYFCGFPFFVDKSVLIPRFDTEVLVEEIL-- 106

Query: 89  SLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
              RI K D   +ILD+ TG+GA+ ++L K   F +   VDIS  ALEIAK NAV  G  
Sbjct: 107 ---RIAKGDKNKKILDMCTGSGAIAISLKKLGGFERVDAVDISNDALEIAKKNAVGLGCD 163

Query: 148 ERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSH 205
             F   +SD FS +  E  +D+IVSNPPYI+S +VD L  EV+DF+PR++LDG IDG+  
Sbjct: 164 INFS--KSDMFSGLTSENKYDIIVSNPPYIKSHMVDSLESEVKDFEPRLALDGDIDGMKF 221

Query: 206 YRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           Y+ I +   ++LN +G+ ++EIGY++  D+ ++F+    F +N  KD    DRV +
Sbjct: 222 YKIIKENFIKYLNPEGILALEIGYDEAKDIRKLFDG---FDINIKKDLSNLDRVAI 274


>gi|114319434|ref|YP_741117.1| HemK family modification methylase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225828|gb|ABI55627.1| [protein release factor]-glutamine N5-methyltransferase
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 295

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 121/219 (55%), Gaps = 6/219 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R L  E +  + G R F+++ L ++++T  PRPETELLV++ALA    R++    +R+
Sbjct: 76  LARRLAGEPVAHLTGRRGFWSLELKVTAETLIPRPETELLVEAALA----RVDGDRQLRV 131

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
            DLGTGTGA+ LAL  E P ++   V+ S  AL +A+ NA   G+++R   +   WF  +
Sbjct: 132 ADLGTGTGAIALALADECPAWRVTAVEASAGALVVARENARRLGLADRVQVVAGSWFGPL 191

Query: 162 EG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            G  FD++VSNPPY+     +    +VR F+PR +L  G DGL   R I      HL   
Sbjct: 192 AGERFDLVVSNPPYVGVHEPELYEGDVR-FEPRSALAAGRDGLGDLRRIVGEAPGHLVAG 250

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
           G   VE G+ Q   V R+F       V   +D  G++RV
Sbjct: 251 GWLMVEHGFQQGEAVRRLFLEAGFGGVETLRDLAGHERV 289


>gi|237742324|ref|ZP_04572805.1| methyltransferase [Fusobacterium sp. 4_1_13]
 gi|229429972|gb|EEO40184.1| methyltransferase [Fusobacterium sp. 4_1_13]
          Length = 370

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 128/222 (57%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 131 VLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 186

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+GTGA+ +A+  E       G+DI+ KA+E+A  N   N + E  + ++SD F  +
Sbjct: 187 LDIGSGTGAISIAIANELKSSSVTGIDINEKAIELANENKTLNKI-ENVNFIKSDLFEKI 245

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     HL  
Sbjct: 246 DKDFKYDLIVSNPPYISKNEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEHLKD 305

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
               + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 306 TAYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 347


>gi|121534883|ref|ZP_01666702.1| modification methylase, HemK family [Thermosinus carboxydivorans
           Nor1]
 gi|121306482|gb|EAX47405.1| modification methylase, HemK family [Thermosinus carboxydivorans
           Nor1]
          Length = 289

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 134/260 (51%), Gaps = 6/260 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  + G     + ++ D  L+  +      A+ + +    +  I G ++F  +  
Sbjct: 33  DAEVLLSHILGRDRLYLYLNYDQPLEPAELAAFREAVKKRVLRVPVAYITGHKEFMGLDF 92

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++SD   PRP+TE+LV++ALA    R+       +LDLGTG+GA+ ++LL       G+
Sbjct: 93  IVTSDVLVPRPDTEVLVEAALA----RLAGVSTPVVLDLGTGSGAIIVSLLHRLQAATGI 148

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLG 184
           GVDIS  AL +A++NA  +GV+ R    Q D F+ V G  FD IV+NPPYI    +  L 
Sbjct: 149 GVDISPGALAVARANAQKHGVAARLALKQGDLFAPVAGQAFDAIVANPPYIPDGDIAGLE 208

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVR  +PR +L GG DGL  YR I      HL      +VE+G  Q   V  +     L
Sbjct: 209 PEVR-HEPRTALAGGADGLDFYRRIVAMAPGHLKDGAFLAVEVGCGQAAAVAGLAAVSGL 267

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
            +    +DY G +RV++  R
Sbjct: 268 GVEAVIRDYAGIERVVVMRR 287


>gi|221135299|ref|ZP_03561602.1| peptide release factor-glutamine N5-methyltransferase(HemK)
           [Glaciecola sp. HTCC2999]
          Length = 286

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 129/256 (50%), Gaps = 8/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V   +   +   PD VL   Q+    + I +    + I  ILG+++FY    
Sbjct: 29  DAQCLLCAVLDCNRAYLHTWPDKVLSSTQQTEFLHFIEQRQTGKPIAYILGYQNFYGYDF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRPETE  VD  +A       K  + R+LDLGTGTGA+ L+++ + P  + +
Sbjct: 89  AVSPVTLIPRPETEQCVDLVIA-------KPYIKRVLDLGTGTGAIALSIILQRPELEVL 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD   +A+ +A+ NA            QSDWFS V+G FDVIVSNPPY+E         
Sbjct: 142 GVDFVPEAVMLAQQNAQNLAPKSNISFKQSDWFSHVDGRFDVIVSNPPYVEPDSPYLAKG 201

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           ++R F+P  +L    +GL+    I      +LN++GL  +E G+ Q  ++ ++       
Sbjct: 202 DIR-FEPNSALTAAENGLADIIRIVSEAKHYLNENGLVILEHGHTQGTEIRQLMTQNGFT 260

Query: 246 LVNAFKDYGGNDRVLL 261
            V    DY G  R+ L
Sbjct: 261 NVTTLCDYAGQHRITL 276


>gi|23015679|ref|ZP_00055448.1| COG2890: Methylase of polypeptide chain release factors
           [Magnetospirillum magnetotacticum MS-1]
          Length = 283

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 131/260 (50%), Gaps = 5/260 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS      V G+   ++     + L       L   + R    E +  ILG R F+    
Sbjct: 26  DSRLMAAEVLGVEMRRLPASHHAELSPEDAARLAAMLDRRAAREPMSHILGRRGFWTHDF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRD-VVRILDLGTGTGAVCLALLKESPFFKG 124
            ++ DT +PRP+TE L+++ L      ++ R   +R++D GTGTG + L LL E     G
Sbjct: 86  LVTKDTLDPRPDTETLIEAVLGA----LDDRGRPLRLVDFGTGTGCILLTLLSELGHATG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +G+D S  AL +A  NA   G++ R      DW   ++G+FD+IVSNPPYI    +D L 
Sbjct: 142 LGIDASEAALAVAGDNAERLGLASRAQFRLGDWGWGLDGVFDIIVSNPPYIPDGDIDGLE 201

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV  ++PR +L GG DGL  YR +   ++R L   GL ++E+G  Q  DV  +  +  L
Sbjct: 202 PEVSRYEPRSALAGGADGLDCYRALIPHMARLLVPGGLAALEVGAGQASDVAAMLAAAGL 261

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
                  D GG +R ++  R
Sbjct: 262 PGAGFRCDLGGIERCVIVQR 281


>gi|294782569|ref|ZP_06747895.1| methyltransferase [Fusobacterium sp. 1_1_41FAA]
 gi|294481210|gb|EFG28985.1| methyltransferase [Fusobacterium sp. 1_1_41FAA]
          Length = 382

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 127/222 (57%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+   + +  ILG  +FY +   +  +   PRP+TE+LV+  +   +  IE+ +   I
Sbjct: 144 MLRAKNRKPLQYILGEWEFYGLPFKVRENVLIPRPDTEILVEQCIQL-MREIEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       GVDI+  A+E+A  N V N V E  + ++SD F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSVTGVDINEDAIELANENKVLNKV-ENVNFMKSDLFEKL 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++F+P+ +L    DGL  YR I+     +L  
Sbjct: 259 DEDFKYDLIVSNPPYITKEEYESLMPEVKNFEPKNALTDLGDGLHFYREISKKAGSYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGY Q  DV +I E     +++  KDYGGNDRV+L
Sbjct: 319 TGYLAFEIGYKQAKDVSKILEDNNFAILSVVKDYGGNDRVVL 360


>gi|296116160|ref|ZP_06834778.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977266|gb|EFG84026.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 291

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 122/221 (55%), Gaps = 4/221 (1%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           RSL HE +  + G   F+++ L +S  T  PR +TE LV++ L     R ++ D+  ILD
Sbjct: 71  RSL-HEPLSYLTGRAGFWSMTLDVSPATLIPRADTETLVEALLEL---RPDRTDISTILD 126

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           LGTGTG + LA L+E P   G+GVD+S  A  +A  NA   G+S+R + +  +W  ++ G
Sbjct: 127 LGTGTGCLLLAALQEYPQAWGLGVDLSPDAARLALGNARNVGLSDRCNIICGNWAQAITG 186

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FDV+ SNPPYI    +  L  +VRD +P  +LDGG DGL  YR +   + R L   GL 
Sbjct: 187 RFDVVFSNPPYIPHADLSGLMPDVRDHEPHRALDGGDDGLVCYRILMQSLPRLLKPRGLG 246

Query: 224 SVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
            VE+G  Q   V  +     + +V    D GG  R L+  R
Sbjct: 247 IVELGIGQDHSVPALARDAGMDIVAIRPDLGGVGRALIVRR 287


>gi|291532655|emb|CBL05768.1| [protein release factor]-glutamine N5-methyltransferase [Megamonas
           hypermegale ART12/1]
          Length = 293

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 134/260 (51%), Gaps = 1/260 (0%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V G     + V  D  ++ ++       + +  +H  +  ILG R+F  +  
Sbjct: 32  DAEVLLSHVLGQKRIYLYVHFDEPMEAKELAKFREYVAKRARHIPVAYILGQREFMGLDF 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ DT  PRP+TE+LV++ +A        +    I+D+GTG+GA+ L+LLK  P  KG 
Sbjct: 92  KVTKDTLIPRPDTEILVENTIAKVNENFGDKQSYDIVDIGTGSGAIILSLLKNLPKAKGF 151

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLG 184
            VDIS   + +AK NA    V +R +    D F  V + +FDVIVSNPPYI    +  L 
Sbjct: 152 TVDISANVVAVAKENAQNLQVDDRCEFFVGDLFEPVKDKVFDVIVSNPPYIPQKDIATLE 211

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
           ++V+D++P  +L    DGLS Y+ +     ++L   G  +VEIG  Q   V ++      
Sbjct: 212 IDVKDYEPLSALTDNKDGLSFYQRLFTQGMKYLKNGGFMAVEIGIYQAEPVKQMAIDNGW 271

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
             +   KDY G DRV+L  +
Sbjct: 272 QNIEIIKDYAGIDRVVLAWK 291


>gi|310659437|ref|YP_003937158.1| methyltransferase [Clostridium sticklandii DSM 519]
 gi|308826215|emb|CBH22253.1| Methyltransferase [Clostridium sticklandii]
          Length = 283

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 135/242 (55%), Gaps = 3/242 (1%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ +  +D+ +   +   I +      +  ILG R+F+ +   +S     PR +TE+L
Sbjct: 39  IMLNLEEDIDESKVEIIKTMIEKRKNSYPLQYILGEREFWGMDFNVSEGVLIPRQDTEIL 98

Query: 82  VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNA 141
           ++  L        K ++ +  ++G G+G + + LLKE      +GVDI+ KA+E+ K+NA
Sbjct: 99  IEETLKKLKNHKHKSNL-KGFEIGVGSGIISITLLKEIETLIMIGVDINDKAIELTKANA 157

Query: 142 VTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGG 199
             + VS+R   L S+ F  +  E  FD I+SNPPYIE+ ++D L  +++  +P+++LDGG
Sbjct: 158 SKHQVSDRLCILNSNLFEKINKENQFDFIISNPPYIETKVIDSLQEDIKQHEPKLALDGG 217

Query: 200 IDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            DGL  YR I +    +++ +G  + EIGYNQ   V +IF       V   KD  G DRV
Sbjct: 218 ADGLDFYRDIIEQSKHYISPEGFIAFEIGYNQAEAVKKIFVENGYQNVTIAKDLAGFDRV 277

Query: 260 LL 261
           ++
Sbjct: 278 VI 279


>gi|152979100|ref|YP_001344729.1| HemK family modification methylase [Actinobacillus succinogenes
           130Z]
 gi|150840823|gb|ABR74794.1| modification methylase, HemK family [Actinobacillus succinogenes
           130Z]
          Length = 286

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 143/265 (53%), Gaps = 10/265 (3%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           + A  D++  L  VT  +  Q+I   D+VLD++    LT  + R    E +  ILG  +F
Sbjct: 24  LNAKFDANLLLQSVTQKTKSQIIAFSDTVLDEKTLQNLTALLNRRATGEPVAYILGETEF 83

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-- 118
           + + L +S  T  PRP+TE+LV+ AL     RI  +D V +LDLGTGTGA+ L+L KE  
Sbjct: 84  WTLSLKVSPHTLIPRPDTEILVERALE----RIPLKDGVSVLDLGTGTGAIALSLAKELK 139

Query: 119 --SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIE 176
                +  +GVD+  +A+ +A+ NA  N + +  +  +S WF+++   FD++VSNPPYI+
Sbjct: 140 KRGQKYWVLGVDLMPEAVVLAQRNAERNQLDD-VEFRRSSWFNNIHETFDLVVSNPPYID 198

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +        +VR F+P  +L     G +  R I +   R+LN  G   +E G+ Q   V 
Sbjct: 199 ADDAHLTQGDVR-FEPLSALIAEEQGYADLRHIIEQTPRYLNPQGWLLLEHGWRQGEKVR 257

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLL 261
             F+      V   KDYG N+RV L
Sbjct: 258 SFFDENLWEKVATVKDYGDNERVTL 282


>gi|328473484|gb|EGF44332.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio parahaemolyticus 10329]
          Length = 285

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEPEQQAQFDALLARRLAGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P  + +
Sbjct: 89  KVSPTTLIPRPDTERLVEVALDKTYGQ-----TGSILDLGTGTGAIALALASELPSRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDC 182
           GVD+  +A E+A+ NA    +    FD  Q  WF  + EG  F +IVSNPPYI+      
Sbjct: 144 GVDLKQEAKELAEYNAAQLNIKNVTFD--QGSWFEPIAEGTKFALIVSNPPYIDEKDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P+ +L    +GL+  R I+D   ++L + G  + E GY+Q   V  I    
Sbjct: 202 SQGDVR-FEPKSALVADENGLADIRHISDLARQYLEEGGWLAFEHGYDQGEAVREIMSGF 260

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V   KDYGGNDRV L C
Sbjct: 261 GYQQVVTEKDYGGNDRVTLGC 281


>gi|322434295|ref|YP_004216507.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acidobacterium sp. MP5ACTX9]
 gi|321162022|gb|ADW67727.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acidobacterium sp. MP5ACTX9]
          Length = 282

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 124/239 (51%), Gaps = 6/239 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           AL D+   L    G+ S  +   P+  +D  Q+     AI R L  E I  ILG ++FY 
Sbjct: 24  ALADAAILLTHTLGIDSTTLRAHPERPIDRDQQAVYQRAIERRLTFEPIQYILGTQEFYG 83

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +   ++     PRPETE LV++  A    R+     VRILD+GTG+GA+ +AL    P  
Sbjct: 84  LPFRVTPAVLIPRPETEHLVEAVAA----RVPHNRPVRILDVGTGSGAIAIALAHLLPHA 139

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIV 180
               +DIS +A+EIA+ NA TN ++ R D  QSD F++V     F  IVSNPPYI     
Sbjct: 140 HITALDISPEAIEIAQENARTNHLAARIDFQQSDLFTAVTKGPPFAAIVSNPPYIPLSDS 199

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           + L  +VRD++P  +L  G  G   Y  +       L  +GL ++EIG  Q+  +  + 
Sbjct: 200 ESLHPQVRDYEPHQALFSGPTGFEVYERLIIQAPSLLLPNGLIALEIGQGQQPRMAELL 258


>gi|28897518|ref|NP_797123.1| HemK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364111|ref|ZP_05776831.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus K5030]
 gi|260879266|ref|ZP_05891621.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus AN-5034]
 gi|260897558|ref|ZP_05906054.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus Peru-466]
 gi|260903528|ref|ZP_05911923.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus AQ4037]
 gi|28805730|dbj|BAC59007.1| HemK protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086348|gb|EFO36043.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus Peru-466]
 gi|308089666|gb|EFO39361.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus AN-5034]
 gi|308110852|gb|EFO48392.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus AQ4037]
 gi|308114222|gb|EFO51762.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus K5030]
          Length = 285

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEPEQQAQFNALLARRLAGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P  + +
Sbjct: 89  KVSPTTLIPRPDTERLVEVALDKTYGQ-----TGSILDLGTGTGAIALALASELPNRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDC 182
           GVD+  +A E+A+ NA    +    FD  Q  WF  + EG  F +IVSNPPY++      
Sbjct: 144 GVDLKQEAKELAEYNAAQLNIKNVTFD--QGSWFEPIAEGTKFALIVSNPPYVDEKDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P+ +L    +GL+  R I+D   ++L + G  + E GY+Q   V  I    
Sbjct: 202 SQGDVR-FEPKSALVADENGLADIRHISDLARQYLEEGGWLAFEHGYDQGEAVREIMRGF 260

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V   KDYGGNDRV L C
Sbjct: 261 GYQQVVTEKDYGGNDRVTLGC 281


>gi|288942096|ref|YP_003444336.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Allochromatium vinosum DSM 180]
 gi|288897468|gb|ADC63304.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Allochromatium vinosum DSM 180]
          Length = 293

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 129/248 (52%), Gaps = 7/248 (2%)

Query: 15  TGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEP 74
           TG +   ++  P+    D         + R L  E I  I G ++F+ + L ++ DT  P
Sbjct: 45  TGWTRTSLLAWPERAPPDEAVATFEALLARRLTGEPIAYIRGRQEFWTLELRVTPDTLIP 104

Query: 75  RPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKAL 134
           RPETE LV+     +L R++ +  +RI DLGTG+GA+  AL  E P +  V  D S  AL
Sbjct: 105 RPETEQLVE----LALDRLDAQRPLRIADLGTGSGAIAAALASERPDWSLVATDRSAAAL 160

Query: 135 EIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
            +A+ N  T G+ ER   L+ DW +++  G  D I+SNPPY+          + R F+PR
Sbjct: 161 AVARDNFRTLGL-ERIGCLRMDWLAALASGSLDAILSNPPYVAGQDPHLDRGDPR-FEPR 218

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L  G DGL   RTIA    R L   GL +VE G++Q   V RIF S  L  V   +D 
Sbjct: 219 SALTPGGDGLDAIRTIAAETGRCLRPGGLLAVEHGFDQGDAVRRIFASAGLHRVETCRDL 278

Query: 254 GGNDRVLL 261
            G DRV L
Sbjct: 279 AGLDRVTL 286


>gi|119945324|ref|YP_943004.1| modification methylase, HemK family protein [Psychromonas
           ingrahamii 37]
 gi|119863928|gb|ABM03405.1| modification methylase, HemK family protein [Psychromonas
           ingrahamii 37]
          Length = 279

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 140/262 (53%), Gaps = 14/262 (5%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           AL D+   L  V    +  ++  P+  L   Q+      I + +K   +  + G R+F++
Sbjct: 20  ALLDAQVLLAFVLEKETVYLMTWPERELSQAQKSAFEGLISQRVKGVPVAHLTGAREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +++ T  PRP+TELLV++AL +           RILDLGTG+GA+ LAL  E P  
Sbjct: 80  LPLKVNNSTLIPRPDTELLVEAALDYCSAD------ARILDLGTGSGAIILALASELPDA 133

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTL---QSDWFSSVEGLFDVIVSNPPYIESVI 179
             +GVD++  A+++A    + NG + + + +   QS+WF ++ GLFDV+VSNPPYIE   
Sbjct: 134 YCLGVDVNESAVQLA----IENGKNLKLNNVHFQQSNWFDNINGLFDVVVSNPPYIEKND 189

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
                 +VR F+P  +L    +GL+  R IA     +L K G   VE G+NQ   V  +F
Sbjct: 190 HHLKLGDVR-FEPLSALVADENGLADIRKIAQKTPEYLKKGGYLLVEHGFNQGSTVRELF 248

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
                  V   KDYG NDRV +
Sbjct: 249 TDLGYSEVITIKDYGDNDRVTM 270


>gi|114766146|ref|ZP_01445150.1| modification methylase, HemK family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114541606|gb|EAU44648.1| modification methylase, HemK family protein [Roseovarius sp.
           HTCC2601]
          Length = 282

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 131/259 (50%), Gaps = 16/259 (6%)

Query: 5   RDSHSFLCRVTGLSSHQV-IVDPDSVLDDRQRFFLTNAIVRS-LKHESIHRILGWRDFYN 62
           RD+   L  V  +   ++ +  PD V  + +   L NA++ S   H  +  I G R FY 
Sbjct: 24  RDARRLLAHVLKVPPGRLTLFLPDPV--ESEHALLFNAVIESRAAHVPVSHITGRRQFYG 81

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               ++ +  +PRPETE+L+++ALA            R+LDLGTG+G + L LL E    
Sbjct: 82  REFLVTPEVLDPRPETEILIEAALAGPF--------SRVLDLGTGSGCILLTLLCEREGA 133

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV----EGLFDVIVSNPPYIESV 178
            G+G D+S +ALE+A  N     +  R    +  WF ++       FD+IVSNPPYI   
Sbjct: 134 TGIGTDLSEEALEVAFWNRNALRLEARAALARGSWFGALGEDDRERFDLIVSNPPYIALD 193

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
            +D L  EVRD +PR++L    DGL+ YR IA G   HL   G   VEIG +Q   V  +
Sbjct: 194 EMDDLSPEVRDHEPRMALTDEGDGLTAYRMIAAGAPSHLLPGGRLMVEIGPSQGAAVADL 253

Query: 239 FESRKLFLVNAFKDYGGND 257
           F S  L  V    D  G D
Sbjct: 254 FRSAGLQEVAVITDLDGRD 272


>gi|239948111|ref|ZP_04699864.1| bifunctional methyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922387|gb|EER22411.1| bifunctional methyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 420

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 135/267 (50%), Gaps = 26/267 (9%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAEIEAFEKLLKRRLKHEPIAYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSALAFSLP--RIEKRDVV-----------------------RILDLGTGTGAVCLALL 116
           V   L    P  R  +R V                        +IL+LGTG+G + ++LL
Sbjct: 103 VRIVLGLLKPSLRATERSVAISGILPEIASSTPMASSRNDEYTKILELGTGSGCIAISLL 162

Query: 117 KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYI 175
            E P    +  DIS  A+EI KSNA    V +R   + SDWF ++ +  FD+IVSNPPYI
Sbjct: 163 CELPNANVIATDISLDAIEIIKSNAAKYEVMDRLQVIHSDWFENLGKQKFDLIVSNPPYI 222

Query: 176 ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDV 235
                  + +E  +++P I+L    DGL  Y+TIA    + L  +G   +EIG+ Q+  V
Sbjct: 223 SHSEKSEMAIETINYEPSIALFAEEDGLQCYKTIAGNAKQFLKPNGKIILEIGFKQEEAV 282

Query: 236 VRIFESRKLFLVNAFKDYGGNDRVLLF 262
            +IF  +   + N ++D  G  RV+LF
Sbjct: 283 TQIFLDQSYNIENVYRDLQGYSRVILF 309


>gi|293392124|ref|ZP_06636458.1| protein methyltransferase HemK [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952658|gb|EFE02777.1| protein methyltransferase HemK [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 299

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 148/270 (54%), Gaps = 15/270 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VT  S   ++   ++ LD++    LT  + R L+ E I  ILG ++F+++ L
Sbjct: 26  DAQVLLQFVTQKSRAFILAFGETALDEKTLEKLTALLARRLQGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEK----RDVVRILDLGTGTGAVCLALL----- 116
            +S+ T  PRP+TE+LV+ A+A ++ +++K        RILDLGTGTGA+ LAL      
Sbjct: 86  NVSAGTLIPRPDTEILVEKAVAIAIEKLQKCGQNSQRFRILDLGTGTGAIALALASALKS 145

Query: 117 ---KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
              K +     +GVD++ + + +AKSN   N ++  F  +QS WF +V G FD+I+SNPP
Sbjct: 146 IAQKHAVQLDIIGVDLTPEVVALAKSNGAKNQLNVTF--VQSRWFENVTGTFDLILSNPP 203

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI++        +VR F+P  +L    +G +  R I     + + ++G   VE G+ Q  
Sbjct: 204 YIDAHDEHLTQGDVR-FEPLSALVAAEEGYADLRHIIANAPKFMRENGYLLVEHGWQQGE 262

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
            V  IF+      V   +DYG N+RV L C
Sbjct: 263 KVRSIFQGNFWSAVETLRDYGNNERVTLGC 292


>gi|300723055|ref|YP_003712353.1| N5-glutamine methyltransferase [Xenorhabdus nematophila ATCC 19061]
 gi|297629570|emb|CBJ90173.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Xenorhabdus nematophila ATCC 19061]
          Length = 286

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 139/259 (53%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   ++++   +   L + + R ++ E I  I+G R+F+++ 
Sbjct: 22  RDAEILLQYVTGCSRTYLIAFSETLISPEEAHQLDSMLARRIRGEPIAYIVGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP        +ILDLGTGTGA+ LAL  E      
Sbjct: 82  LAVSPATLIPRPDTECLVEKALEL-LP----DSPAQILDLGTGTGAIALALASERHDCHV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERF---DTLQSDWFSSV-EGLFDVIVSNPPYIESVIV 180
            GVDI+  A+ +AK NA  N     F   + LQS+WF+ V    FD+IVSNPPYI+    
Sbjct: 137 TGVDINPDAVALAKRNAERNTEKLPFHYVNFLQSEWFAEVGHRQFDMIVSNPPYIDEADP 196

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P  +L    +G++  +TI +     L  +G   +E G+ Q   V  +F 
Sbjct: 197 HLREGDVR-FEPATALIAAQNGMADLQTIVEQARHFLLPNGWLLLEHGWKQGTVVRNLFL 255

Query: 241 SRKLFLVNAFKDYGGNDRV 259
            +    +  F+DYGGN+R+
Sbjct: 256 EKGYQRIATFQDYGGNERI 274


>gi|91206058|ref|YP_538413.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia bellii RML369-C]
 gi|122425238|sp|Q1RH40|HEMK_RICBR RecName: Full=Bifunctional methyltransferase; Includes: RecName:
           Full=HemK protein homolog; Includes: RecName: Full=tRNA
           (guanine-N(7)-)-methyltransferase; AltName:
           Full=tRNA(m7G46)-methyltransferase
 gi|91069602|gb|ABE05324.1| Methylase of polypeptide chain release factors [Rickettsia bellii
           RML369-C]
          Length = 556

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 139/262 (53%), Gaps = 23/262 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++ +P+  L+  +   +   + R LKHE I  ILG ++FY+    ++     PR +TE+L
Sbjct: 43  LLANPEKQLNQLEIEAVEKVLERRLKHEPIAYILGTKEFYSREFIVNKHVLIPRNDTEIL 102

Query: 82  VDSALAFSLPR-------------------IEKRDVVR---ILDLGTGTGAVCLALLKES 119
           +D  L +                       ++ R+ ++   IL+LGTG+G + ++LL E 
Sbjct: 103 IDVVLQYHSQHSLCHSSNGGNPDKKQLDSVVKPRNNIKSSNILELGTGSGCISISLLLEL 162

Query: 120 PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESV 178
           P  +    DIS  A+E+AKSNA+ + V++R   + S+WF ++ +  FD+IVSNPPYI   
Sbjct: 163 PNSQITATDISIDAIEVAKSNAIKHDVTDRLQIIHSNWFENIGKQKFDLIVSNPPYISIN 222

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
               + +E  +++P I+L    DGL  Y+ IA+   + L ++G   +EIGY Q   V +I
Sbjct: 223 EKPEMAIETINYEPSIALFAEEDGLLSYKIIAENAKKFLKQNGKIILEIGYKQADQVSQI 282

Query: 239 FESRKLFLVNAFKDYGGNDRVL 260
           F      + N  +D   ++RV+
Sbjct: 283 FLDHGYVIDNIHQDLQSHNRVI 304


>gi|197301353|ref|ZP_03166434.1| hypothetical protein RUMLAC_00080 [Ruminococcus lactaris ATCC
           29176]
 gi|197299510|gb|EDY34029.1| hypothetical protein RUMLAC_00080 [Ruminococcus lactaris ATCC
           29176]
          Length = 306

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 90/266 (33%), Positives = 137/266 (51%), Gaps = 13/266 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG+      ++PD  ++          +    +H  +  I G ++F  +  
Sbjct: 37  DAWYLLEFVTGVDKAHYYMNPDRRMEQSVAQEYEKVVKLRTEHIPLQHITGVQEFMGLEF 96

Query: 66  TLSSDTFEPRPETELLVDSALAF----SLPRIEKRDVVRILDLGTGTGAVCLALL----K 117
            +S D   PR +TE+LV+ AL       +P+  +++ VR+LDL TG+G + +++L    K
Sbjct: 97  QVSGDVLIPRQDTEVLVEEALKLLEQEKVPK--EKETVRMLDLCTGSGCILISILYYAAK 154

Query: 118 ESPFFKGVGVDISCKALEIAKSNA---VTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPY 174
           E    +G G DIS  AL IA+ N      NG     + L+SD F  V+G F +IVSNPPY
Sbjct: 155 EKIQIQGTGADISEAALRIAEENLDLLEKNGNKGMAELLESDLFEQVDGTFGMIVSNPPY 214

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I++ ++  L  EVR  DP ++LDG  DGL  YR I +    +L K+G+   EIGY+Q   
Sbjct: 215 IKTSVISGLQEEVRLHDPFLALDGKEDGLFFYRKIIEESRAYLQKNGVLLFEIGYDQGEA 274

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVL 260
           V  +        V   KD  G DR++
Sbjct: 275 VSELMTKEGYGQVVVKKDLAGLDRIV 300


>gi|34763569|ref|ZP_00144504.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|27886758|gb|EAA23896.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
          Length = 370

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 131 VLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 186

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+E+A  N   N + E  + ++SD F  +
Sbjct: 187 LDIGSGSGAISIAIANELKSSSVTGIDINEKAIELANENKTLNKI-ENVNFIKSDLFEKI 245

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 246 DKDFKYDLIVSNPPYISKNEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 305

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 306 TGYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 347


>gi|162147701|ref|YP_001602162.1| HemK protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542325|ref|YP_002274554.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786278|emb|CAP55860.1| putative hemK homolog protein [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530002|gb|ACI49939.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 293

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 122/239 (51%), Gaps = 5/239 (2%)

Query: 28  SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA 87
           S +D  +       + R   HE +  I G   F+++ L  +  T  PR ++E LV++ LA
Sbjct: 57  SAMDAAEHRSFVALVARRAAHEPMAYITGRAGFWSLDLETAPATLIPRADSETLVEALLA 116

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
               R ++  V  ILDLGTGTG + LA L E P   G+GVDI   A  +A  NA   G+ 
Sbjct: 117 Q---RPDRGAVRTILDLGTGTGCLLLAALSEYPDAWGLGVDIDPDAAHLAARNARRTGLR 173

Query: 148 ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
           +R   L +DW +++ G FDV+ SNPPYI    +  L  +VRD +P  +LDGG DGL  YR
Sbjct: 174 DRCAMLAADWSTAIAGRFDVVFSNPPYIPRADLAGLMPDVRDHEPARALDGGTDGLDAYR 233

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF--CR 264
            +   +   L   G+   EIG  Q+  +  +     L +V    D GG  R +L   CR
Sbjct: 234 LLTGALPSLLAHGGIAIFEIGIGQERSMPDLARQAGLDIVGIRTDLGGIPRAVLMQQCR 292


>gi|126462319|ref|YP_001043433.1| HemK family modification methylase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103983|gb|ABN76661.1| modification methylase, HemK family [Rhodobacter sphaeroides ATCC
           17029]
          Length = 278

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 131/259 (50%), Gaps = 8/259 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A RD+   +     +   ++ +     L          A+      + + +I+G R F+
Sbjct: 21  EAARDARRLMAHAMAIDPARLTLHLPDPLPPEAAARFEAALAARAARQPVGQIVGERLFW 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
             R  ++ DT +PRPETE L+++ALA             +LDLGTGTG + + LL E P 
Sbjct: 81  GRRFRVTRDTLDPRPETEGLIEAALAEPF--------ATVLDLGTGTGCIAVTLLAERPA 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVD 181
             G+  D+S  AL +A  NA   G + R +   SDWF++V    D+I+SNPPYI +  +D
Sbjct: 133 AHGIATDLSPAALAVAAENAAALGAASRLELRLSDWFAAVPERVDLILSNPPYIAADEMD 192

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EVR ++P ++L  G DGL  YR IA G   HL   G   +EIG  Q   V  + E+
Sbjct: 193 TLAPEVRLWEPHLALSPGGDGLDAYRAIARGAPAHLRPGGRLLLEIGAAQGRAVAGLVEA 252

Query: 242 RKLFLVNAFKDYGGNDRVL 260
             L  V+   D  G DR++
Sbjct: 253 AGLARVSVLPDLDGRDRLV 271


>gi|294010050|ref|YP_003543510.1| methylase of polypeptide chain release factors [Sphingobium
           japonicum UT26S]
 gi|292673380|dbj|BAI94898.1| methylase of polypeptide chain release factors [Sphingobium
           japonicum UT26S]
          Length = 275

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 84/223 (37%), Positives = 123/223 (55%), Gaps = 14/223 (6%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R L  E I  I G RDF+ + L ++ D   PRP++E L+++AL    PR       RI
Sbjct: 57  IQRRLTGEPIAYITGTRDFWTISLHVTPDVLIPRPDSETLIEAALDHFGPR----SPARI 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+GA+ LA L + P   G GVDIS  A+ +A+ NA   G+  R +    DW   +
Sbjct: 113 LDLGTGSGALLLAALSQWPQATGTGVDISPAAVAVAQGNADRLGLGGRANFRLGDWAEGM 172

Query: 162 EGLFDVIVSNPPYI---ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
            G FD+I+ NPPYI    ++  D L       +P  +L  G +GL  YR IA  + R L 
Sbjct: 173 GGPFDLILVNPPYIARDAALAGDVL------HEPETALFAGAEGLDDYRRIAPALPRLLA 226

Query: 219 KDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             G+ ++EIG++Q++ V  +   + L  V+  +D  G+DR L+
Sbjct: 227 PGGMAAMEIGHDQRLSVSALLADQGLG-VSPRRDLAGHDRCLV 268


>gi|257870910|ref|ZP_05650563.1| modification methylase HemK [Enterococcus gallinarum EG2]
 gi|257805074|gb|EEV33896.1| modification methylase HemK [Enterococcus gallinarum EG2]
          Length = 278

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 118/217 (54%), Gaps = 8/217 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H     +LG+ +FY  R  ++ DT  PRPETE LV    A  L + E  + +R++D+G
Sbjct: 65  LAHRPPQYLLGYEEFYGHRFKVTEDTLIPRPETEELV----ALCLEQTEPAENLRVVDIG 120

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL 164
           TGTGA+ ++L    P ++   VD+S  AL +AK NA   G    F   Q D  + V +  
Sbjct: 121 TGTGAIAVSLKLARPHWQIAAVDLSEAALAVAKENAAQLGAEVAF--YQGDTLTPVGDQS 178

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           +D+IVSNPPYI     + +   VR F+P+++L    +GL  YR IAD   + L  DG   
Sbjct: 179 WDIIVSNPPYISEQEWELMDASVRQFEPQMALFAAENGLVMYRKIADQAKKLLTPDGKIF 238

Query: 225 VEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           VEIG+ Q   V RIF E+     V   +D  G DR++
Sbjct: 239 VEIGFQQGKSVQRIFAEAFPDKKVTVIQDLSGKDRLV 275


>gi|322517016|ref|ZP_08069905.1| protein-(glutamine-N5) methyltransferase [Streptococcus
           vestibularis ATCC 49124]
 gi|322124433|gb|EFX95930.1| protein-(glutamine-N5) methyltransferase [Streptococcus
           vestibularis ATCC 49124]
          Length = 277

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 124/219 (56%), Gaps = 14/219 (6%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H+    ILG+ DF+ +R  +      PRPET+ LVD  LA + P  E    ++ILD+GTG
Sbjct: 65  HKPAQYILGYEDFHGLRFQVDERVLIPRPETKELVDLILAEN-PSSE----LKILDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDV 167
           +GA+ ++L K  PF++    D+S  AL +AK NA  N V   F  +QSD F ++ G FD+
Sbjct: 120 SGAISVSLKKSCPFWQVTASDLSADALVLAKENAKLNQVDISF--VQSDVFENISGSFDI 177

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI     D +GL V   +P+++L    +GL+ YR I +  +++L   G    EI
Sbjct: 178 IVSNPPYISENDKDEVGLNVLTSEPKMALFADEEGLAIYRQIIEDATKYLTPKGKLYFEI 237

Query: 228 GYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           GY Q +D+ R+    F  +    V   KD  G DR+++ 
Sbjct: 238 GYKQGLDLKRLLSLHFPDKH---VRVLKDQFGQDRMVVM 273


>gi|58038520|ref|YP_190484.1| HemK family protein [Gluconobacter oxydans 621H]
 gi|58000934|gb|AAW59828.1| HemK family protein [Gluconobacter oxydans 621H]
          Length = 282

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 93/260 (35%), Positives = 136/260 (52%), Gaps = 5/260 (1%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A R++   LC  TG      ++  D V +  Q      A+ R L+ E +  I G   F+ 
Sbjct: 24  ARREARLLLCWATG-RDLGGLLSLDGV-EPAQELRFAEALKRRLEREPLAFITGETGFWT 81

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L    DT  PR ++E L++ AL  + P  ++   + ILDLGTGTG + LA L E P  
Sbjct: 82  LDLETGRDTLIPRADSEALIE-ALLDACP--DRSAPLSILDLGTGTGCLLLAALSEYPQA 138

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +GVGVD+S +A  +AK N+V  G+ +R   L   W  ++ G FDV++SNPPYIES  +  
Sbjct: 139 RGVGVDLSPQAAALAKRNSVRTGLEKRSAFLAGSWADALTGRFDVVLSNPPYIESGDLAG 198

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EV  ++P  +LDGG DGL  YR +   +   L + G   +E+G  Q   V  +  + 
Sbjct: 199 LMPEVLQYEPARALDGGADGLDAYRILCAALPGLLVRGGYAILEMGIGQIDAVSALGTAS 258

Query: 243 KLFLVNAFKDYGGNDRVLLF 262
            L  V    D GG +R L+ 
Sbjct: 259 GLRDVAHKADLGGIERALVL 278


>gi|229826187|ref|ZP_04452256.1| hypothetical protein GCWU000182_01559 [Abiotrophia defectiva ATCC
           49176]
 gi|229789057|gb|EEP25171.1| hypothetical protein GCWU000182_01559 [Abiotrophia defectiva ATCC
           49176]
          Length = 283

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 138/262 (52%), Gaps = 14/262 (5%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L +V+GL+  +  +  D  +D+ +       I R  +   +  ++G RDF 
Sbjct: 26  EAELDARYILEKVSGLNRAEYFLHSDDKIDNDKTEEFLRLIERRSERIPLSYVIGTRDFM 85

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG--AVCLALLKES 119
            +   ++ +   P  ETELL +  +     +        +LD+ TG+G  A+ ++LL E 
Sbjct: 86  GLTFKVNENVLIPEQETELLAEEVIKHCKGKT-------VLDMCTGSGCIAISVSLLGEP 138

Query: 120 PFFKGVGVDISCKALEIAKSNA-VTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESV 178
              +    DIS KALE+AK NA   N  + +F  ++ D F ++ G FD+IVSNPPYIE+ 
Sbjct: 139 S--EVTASDISDKALEVAKENAEFLNASTVKF--IKGDLFENITGSFDIIVSNPPYIETR 194

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
           +++ L  EVRD+ PR++LDG  DGL  Y+ I     ++LNK+     EIGYNQ   V  I
Sbjct: 195 VIEELEPEVRDYIPRLALDGDEDGLKFYKNITKKAIKYLNKNARIFYEIGYNQSEAVTDI 254

Query: 239 FESRKLFLVNAFKDYGGNDRVL 260
                   +   KDY G DR++
Sbjct: 255 LLENGFEEIKIIKDYSGLDRIV 276


>gi|262068282|ref|ZP_06027894.1| ribosomal protein L11 methyltransferase [Fusobacterium
           periodonticum ATCC 33693]
 gi|291378020|gb|EFE85538.1| ribosomal protein L11 methyltransferase [Fusobacterium
           periodonticum ATCC 33693]
          Length = 382

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+   + +  ILG  +FY +   +  +   PRP+TE+LV+  +   +  IE+ +   I
Sbjct: 144 MLRAKSRKPLQYILGEWEFYGLPFKVRENVLIPRPDTEILVEQCIQL-MREIEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       GVDI+ +A+++A  N + N V E  + ++SD F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSVTGVDINEEAIKLANENKILNKV-ENINFMKSDLFEKL 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++F+P+ +L    DGL  YR I+     +L +
Sbjct: 259 DEDFKYDLIVSNPPYITKEEYESLMPEVKNFEPKNALTDLGDGLHFYREISKKAGSYLKE 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGY Q  DV +I E     +++  KDYGGN+RV+L
Sbjct: 319 SGYLAFEIGYKQAKDVSKILEDNGFAILSVVKDYGGNNRVVL 360


>gi|312863896|ref|ZP_07724134.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus vestibularis F0396]
 gi|311101432|gb|EFQ59637.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus vestibularis F0396]
          Length = 277

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 124/219 (56%), Gaps = 14/219 (6%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H+    ILG+ DF+ +R  +      PRPET+ LVD  LA + P  E    ++ILD+GTG
Sbjct: 65  HKPAQYILGYEDFHGLRFQVDERVLIPRPETKELVDLILAEN-PSSE----LKILDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDV 167
           +GA+ ++L K  PF++    D+S  AL +AK NA  N V   F  +QSD F ++ G FD+
Sbjct: 120 SGAISVSLKKSCPFWQVTASDLSADALVLAKENAKLNQVDISF--VQSDVFENISGSFDI 177

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI     D +GL V   +P+++L    +GL+ YR I +  +++L   G    EI
Sbjct: 178 IVSNPPYISENDKDEVGLNVLTSEPKMALFADEEGLAIYRQIIEDATKYLTPKGKLYFEI 237

Query: 228 GYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           GY Q +D+ R+    F  +    V   KD  G DR+++ 
Sbjct: 238 GYKQGLDLKRLLSLHFPDKH---VRILKDQFGQDRMVVM 273


>gi|322373125|ref|ZP_08047661.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus sp. C150]
 gi|321278167|gb|EFX55236.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus sp. C150]
          Length = 277

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 131/229 (57%), Gaps = 15/229 (6%)

Query: 38  LTNAIVRSLK-HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKR 96
           L ++I   LK H+    ILG+ DF+ +R  +      PRPETE LV+  LA + P+ E  
Sbjct: 54  LLSSIFNQLKAHKPAQYILGFEDFHGLRFQVDKRVLIPRPETEELVELILAEN-PKTE-- 110

Query: 97  DVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSD 156
             +++LD+GTG+GA+ ++L +  P ++    D+S  ALE+A+ NA  N V   F  +QSD
Sbjct: 111 --LKVLDIGTGSGAIAVSLKESCPLWQVTASDLSVDALELARENAKLNRVDISF--IQSD 166

Query: 157 WFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            F ++ G FD+IVSNPPYI     + +GL V   +P+++L    DGL+ YR I +  ++H
Sbjct: 167 VFENISGSFDIIVSNPPYISENDKNEVGLNVLTSEPKLALFADEDGLAIYRQIIERAAKH 226

Query: 217 LNKDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLL 261
           L+  G    EIGY Q  D+ ++    F  +    V   KD  G DR+++
Sbjct: 227 LSPQGKLYFEIGYKQGSDLKKLLSLHFPDK---CVRVLKDQFGQDRMVV 272


>gi|254515299|ref|ZP_05127360.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [gamma proteobacterium NOR5-3]
 gi|219677542|gb|EED33907.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [gamma proteobacterium NOR5-3]
          Length = 278

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 54  ILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCL 113
           +LG RDF+ + LT++  T  PRP+TELLV+ ALA  LP     +   +LDLGTG+GA+ L
Sbjct: 70  LLGTRDFWTLSLTVNEATLIPRPDTELLVEQALALELP-----ESATVLDLGTGSGAIAL 124

Query: 114 ALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
           AL  E P ++ +GV+ S +AL +A  NA   G+ +    L SDWFS V G FD+IVSNPP
Sbjct: 125 ALATERPQWRVLGVERSPEALAVAIDNARQLGL-DSVQWLSSDWFSQVVGRFDLIVSNPP 183

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI          ++R F+PR +L  G DGL   R I      HL   G   +E G+ Q  
Sbjct: 184 YIADQDAHLATGDLR-FEPRSALASGSDGLDDIRKIIARSPDHLEPGGHLLLEHGFEQAP 242

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRV 259
            V  +  +     V ++ D  G++RV
Sbjct: 243 AVRALLTATGFANVASYDDLAGHERV 268


>gi|261867617|ref|YP_003255539.1| protein-(glutamine-N5) methyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412949|gb|ACX82320.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 299

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 148/270 (54%), Gaps = 15/270 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VT  S   ++   ++ LD++    LT  + R L+ E I  ILG ++F+++ L
Sbjct: 26  DAQVLLQFVTQKSRAFILAFGETALDEKTLEKLTALLARRLQGEPIAYILGEKEFWSLPL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEK----RDVVRILDLGTGTGAVCLALL----- 116
            +S+ T  PRP+TE+LV+ A+A ++ +++K        RILDLGTGTGA+ LAL      
Sbjct: 86  NVSAGTLIPRPDTEILVEKAVAIAIEKLQKCGQNSQRFRILDLGTGTGAIALALASALKP 145

Query: 117 ---KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
              K +     +GVD++ + + +AKSN   N ++  F  +QS WF +V G FD+I+SNPP
Sbjct: 146 IAQKHTVQLDIIGVDLTPEVVALAKSNGEKNQLNVAF--VQSCWFENVTGTFDLILSNPP 203

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI++        +VR F+P  +L    +G +  R I     + + ++G   VE G+ Q  
Sbjct: 204 YIDAHDEHLTQGDVR-FEPLSALVAAEEGYADLRHIIANAPKFMRENGYLLVEHGWQQGE 262

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
            V  IF+      V   +DYG N+RV L C
Sbjct: 263 KVRSIFQENFWSAVETLRDYGNNERVTLGC 292


>gi|258645289|ref|ZP_05732758.1| protein-(glutamine-N5) methyltransferase [Dialister invisus DSM
           15470]
 gi|260402639|gb|EEW96186.1| protein-(glutamine-N5) methyltransferase [Dialister invisus DSM
           15470]
          Length = 288

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 137/262 (52%), Gaps = 9/262 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L  V G S   +  + + +L  ++       I + ++  S   I+G ++F  + L
Sbjct: 31  DSEILLSHVLGKSRIYLYTEFERILAAKELALFKKYIQKRIEGFSAAAIIGKKEFMGLTL 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PRP+TE  ++  + +          +++ DLGTG+GA+ +  L       GV
Sbjct: 91  KVNEQVLIPRPDTETWLEKVIQY----YRNETGLKVADLGTGSGAILVGFLYYCRDAVGV 146

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCL 183
           GVDIS +AL+IA+ N     +++R +  Q D+  +   E +FD I SNPPYI +  +  L
Sbjct: 147 GVDISTEALKIAEENGQNLKLTDRVEWRQGDYLKAFDEEDIFDGIFSNPPYIPTKDIGGL 206

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ESR 242
             EV+  +PR++LDGG DGL  Y  +A G + HL   G  +VE G  Q  D++ +F +S 
Sbjct: 207 PGEVKH-EPRLALDGGTDGLYFYHLLAKGAAEHLKPGGFLAVEFGIGQATDILEMFRKSA 265

Query: 243 KLFLVNAFKDYGGNDRVLLFCR 264
           +       KDYGG +R  L+CR
Sbjct: 266 QYEDFEVIKDYGGIERA-LYCR 286


>gi|312865012|ref|ZP_07725240.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus downei F0415]
 gi|311099123|gb|EFQ57339.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus downei F0415]
          Length = 276

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 123/221 (55%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L HE    ILG+  F++++L +      PRPET  LVD  LA +       + + +LD
Sbjct: 61  RLLAHEPAQYILGYETFHDLKLKVDKRILIPRPETAELVDLILAEN-----ADEQLDLLD 115

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           +GTG+GA+ LAL  E P ++ V  DIS +AL++AK NA  N ++   D  QSD FS +  
Sbjct: 116 IGTGSGAIALALAHERPTWRIVASDISQEALDLAKENAQANQIA--VDFCQSDLFSQLSV 173

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            +D+IVSNPPYI       +GL V   +P ++L    +GL+ YR +A    +HL  DG  
Sbjct: 174 SYDIIVSNPPYISEADKAEVGLNVLTSEPHLALFADEEGLAIYRKLAQQAGKHLKADGKI 233

Query: 224 SVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVLL 261
            +EIGY Q   V ++F  R+ F    V    D  G DR+++
Sbjct: 234 YLEIGYKQGQIVSQLF--REAFPDKRVRVLPDQFGQDRMVV 272


>gi|254302819|ref|ZP_04970177.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
 gi|148323011|gb|EDK88261.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
          Length = 383

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 127/224 (56%), Gaps = 11/224 (4%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR- 100
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +         RD+   
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQLM------RDIEEP 197

Query: 101 -ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS 159
            ILD+GTG+GA+ +A+  E       G+DI+ KAL++A  N + N + E  + ++S+ F 
Sbjct: 198 NILDIGTGSGAISIAIANELKSSSVTGIDINEKALKLANENKILNKI-ENVNFIESNLFE 256

Query: 160 SVEGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHL 217
            ++  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L
Sbjct: 257 KLDKDFKYDLIVSNPPYISKEEYEILMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYL 316

Query: 218 NKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
              G  + EIGYNQ  DV +I +     +++  KDYGGNDRV++
Sbjct: 317 KDTGYLAYEIGYNQAKDVSKILQDNNFAILSIVKDYGGNDRVII 360


>gi|226329847|ref|ZP_03805365.1| hypothetical protein PROPEN_03759 [Proteus penneri ATCC 35198]
 gi|225200642|gb|EEG82996.1| hypothetical protein PROPEN_03759 [Proteus penneri ATCC 35198]
          Length = 282

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 139/256 (54%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT  +   ++   +++L   +   L+  + R +K E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTQRARTYLMAFNETLLSQDELTQLSQLLTRRIKGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP     + + ILDLGTGTGA+ LA+  E P    
Sbjct: 82  LKVSPATLIPRPDTECLVEQALE-KLP----TEPITILDLGTGTGAIALAMASERPDCHI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
           +GVD   +A+ +A+ NA    ++   + ++S WFSS+ G  F +I+SNPPYI+       
Sbjct: 137 IGVDFQAEAVALAQENATRLALNNT-EFMESCWFSSLSGYQFGMIISNPPYIDENDEHIH 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G +G +    I +   + L   G   +E G+ Q   V +IF  + 
Sbjct: 196 QGDVR-FEPLTALVAGNNGFADIEIIIETARQFLTDKGWVLLEHGWQQGEGVRKIFTDKG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V  F+DYGGN+RV
Sbjct: 255 YCCVETFRDYGGNERV 270


>gi|189424096|ref|YP_001951273.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Geobacter lovleyi SZ]
 gi|189420355|gb|ACD94753.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Geobacter lovleyi SZ]
          Length = 286

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 131/260 (50%), Gaps = 11/260 (4%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A R++   LC  TGL    + ++ D  L D +     + + R  K E +  ILG ++F  
Sbjct: 29  ARREAEWLLCEATGLDRMGLYLNFDKPLQDDELAAYRSMVARRGKREPLQHILGSQEFDG 88

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR-ILDLGTGTGAVCLALLKESPF 121
           +   ++ D   PR +TE L++ A       + +    R +LD+GTG+G + ++L    P 
Sbjct: 89  LEFIVTRDVLIPRFDTETLLEEA-------VRQAPTARTVLDIGTGSGCIAISLFHRLPQ 141

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIV 180
                VD+S  AL IA+ NA  N     F  L   +F  V E  FD+IVSNPPYI S  +
Sbjct: 142 AAITAVDLSPDALSIARRNAERNNAQIEF--LLGSFFQPVSERRFDLIVSNPPYITSADL 199

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             L  EVRDF+PR++LDGG DGL  YR +A    R+L  +G   +EIG  Q  DV  +  
Sbjct: 200 ADLQPEVRDFEPRLALDGGTDGLDAYRVLAAEAPRYLEPNGWLLLEIGAGQDKDVATLLA 259

Query: 241 SRKLFLVNAFKDYGGNDRVL 260
                 + +  D  G  RV+
Sbjct: 260 DAGFDAIVSVPDNAGIIRVV 279


>gi|50085502|ref|YP_047012.1| methyl transferase [Acinetobacter sp. ADP1]
 gi|49531478|emb|CAG69190.1| methyl transferase [Acinetobacter sp. ADP1]
          Length = 274

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 140/259 (54%), Gaps = 12/259 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  +  L+S ++ +    +L   Q     + ++R  K E +  I G + F+++ 
Sbjct: 19  QEAMWLLEHILELNSLELKMRQMQILTQEQEQQYLDGLMRLSKGEPLAYITGSQPFWSLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP+TE+L+++ L+  LP     +   ++DLGTGTGA+ L+L KE P++K 
Sbjct: 79  LNVTPDTLVPRPDTEILIETVLSLDLP-----EHCSMVDLGTGTGAIALSLAKERPYWKI 133

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
           +  DI    LE+A+SNA  + +++ +F  L S WF ++    FD+IVSNPPYI++     
Sbjct: 134 LATDIYFPTLEVAQSNAKKHALNQVKF--LCSAWFEAIPSQKFDLIVSNPPYIDANDEHM 191

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L L     +PR +L     GL+    I       LN  G  +VE GY+Q   V ++    
Sbjct: 192 LNLGT---EPRRALVADKHGLADLEQIIGQAVLWLNTHGWIAVEHGYDQGQAVCQLLMDH 248

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               V   KDYGGNDR+ L
Sbjct: 249 NFAKVQTCKDYGGNDRISL 267


>gi|153854178|ref|ZP_01995486.1| hypothetical protein DORLON_01477 [Dorea longicatena DSM 13814]
 gi|149753227|gb|EDM63158.1| hypothetical protein DORLON_01477 [Dorea longicatena DSM 13814]
          Length = 287

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/264 (33%), Positives = 137/264 (51%), Gaps = 12/264 (4%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L   TG+S    + DPD  +++ +       I    +   +  I G ++F 
Sbjct: 26  EAKLDAWYLLEYKTGISRAVFLADPDREVEEEKAESYQKDICTRARRIPLQHITGEQEFM 85

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLK---- 117
            +   ++ +   PR +TE+LV+ AL    P ++      ILD+ TG+G +  ++LK    
Sbjct: 86  GLNFKVNENVLVPRQDTEILVEEALKRIRPDMQ------ILDMCTGSGCILESILKFGEK 139

Query: 118 ESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIES 177
           +    KG G DIS +AL++A+ N    G   RF  ++SD F SV   +D+IVSNPPYI +
Sbjct: 140 KQMHLKGTGCDISEEALKVARENNSRLGTDARF--IKSDLFESVTEKYDMIVSNPPYIRT 197

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
             +  L  EV+  DP I+LDG  DGL  YR I     R+LNK G    EIG++Q  DV  
Sbjct: 198 EEISRLDEEVKLHDPWIALDGKEDGLYFYRLIVKDSIRYLNKGGYILFEIGFDQGKDVSE 257

Query: 238 IFESRKLFLVNAFKDYGGNDRVLL 261
           + ++     +   KD  G DRV++
Sbjct: 258 LLKNEGYEEIEIKKDLAGLDRVVM 281


>gi|323143930|ref|ZP_08078588.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Succinatimonas hippei YIT 12066]
 gi|322416294|gb|EFY06970.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Succinatimonas hippei YIT 12066]
          Length = 273

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 131/255 (51%), Gaps = 13/255 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V       +I   +  L +R      + I R  + E I  ILG+++F+ +  
Sbjct: 25  DADLLLMEVLHCPRSYLITHDNEELKERAIVRFRDLISRRSRGEPIAYILGYKEFWGLPF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ +   PRP+TELLV++AL F       + V  +LDLGTG+GA+ L++  E P    +
Sbjct: 85  KVNRNVLIPRPDTELLVETALKF-------KQVKSVLDLGTGSGAIILSIKYERPDINAL 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
             DIS  AL++AK NA++ G+   F   +S WFS ++   FD+IVSNPPYIE    +   
Sbjct: 138 ACDISDAALQVAKENALSLGLDVTF--FKSSWFSDIKNAKFDLIVSNPPYIEE---NDEH 192

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
           L+   F+P  +L  G DGL   R IA       N  G   +E GYNQ  DV  I E    
Sbjct: 193 LKALSFEPVGALISGKDGLDDIRIIAKDSRHFFNPGGALLLEHGYNQGKDVRNILEECGF 252

Query: 245 FLVNAFKDYGGNDRV 259
             +   +D G N+RV
Sbjct: 253 NEIKTLRDLGSNERV 267


>gi|227510127|ref|ZP_03940176.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227190332|gb|EEI70399.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 288

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 136/246 (55%), Gaps = 5/246 (2%)

Query: 16  GLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPR 75
           G S+  +++     +   Q     N + R +  E +  I+G  DFY + L + S+   PR
Sbjct: 40  GFSTTDMLIHYHDRMSSGQWLQFQNDVKRLISGEPVQYIVGQADFYGLTLNVDSNVLIPR 99

Query: 76  PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALE 135
            ETE LVD  L      +     +++LD+GTG+GA+ +AL    P ++    DIS  AL+
Sbjct: 100 VETEELVDWIL--DQTTVYTNRPLKVLDIGTGSGAIAIALKANRPEWQVNASDISDSALK 157

Query: 136 IAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRIS 195
           +A+ NA  + V+  F  + SD F+ +   FD+IVSNPPYI +  V  +   V++ +P+I+
Sbjct: 158 VAQQNAQLHHVAINF--ILSDIFAHINEAFDLIVSNPPYISASEVGDMDSSVKNNEPKIA 215

Query: 196 LDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYG 254
           L    DGL+ Y+++A GV  HLN  G   VEIG++Q+  V +IF E+    +V A  D  
Sbjct: 216 LFAADDGLAIYKSLAKGVDAHLNAGGQLFVEIGFHQEASVRKIFQEALPNAIVTAKHDVS 275

Query: 255 GNDRVL 260
           G+ R++
Sbjct: 276 GHQRMV 281


>gi|158321601|ref|YP_001514108.1| HemK family modification methylase [Alkaliphilus oremlandii OhILAs]
 gi|158141800|gb|ABW20112.1| modification methylase, HemK family [Alkaliphilus oremlandii
           OhILAs]
          Length = 289

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 130/263 (49%), Gaps = 10/263 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V  +    + + P+  +   +       + +   H  +  I+  ++F  +  
Sbjct: 26  DAEVLLYNVLKVDRLHLHMYPEKEISKEEEALFWTYMAQRKNHMPVQYIIKKQEFMGLDF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLK--ESPFFK 123
            +      PR +TE+LV+ A+     + E + V RI+D+GTG+GA+ ++L K  E+    
Sbjct: 86  FVEEGVLIPRGDTEILVEKAIEIYKEKFEPQKV-RIMDIGTGSGAIVVSLAKFIENSIL- 143

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-----FDVIVSNPPYIESV 178
              +DIS KA E+AK NA  +GV  +        F ++ G      +D IVSNPPYI   
Sbjct: 144 -TAIDISPKAFEVAKKNAAHHGVDHKIAFYLGSLFEALYGKDEHKEYDFIVSNPPYIPKA 202

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
           +VD L   V+D++P ++LDGG DGL  YR I  G   +L   G    EIGY+Q   V  +
Sbjct: 203 VVDTLDAGVKDYEPHLALDGGADGLDFYREITLGAKEYLKSGGWLLFEIGYDQGESVSEL 262

Query: 239 FESRKLFLVNAFKDYGGNDRVLL 261
             +  L  V   KD  G DRV+L
Sbjct: 263 LIANDLKEVQVRKDLAGLDRVVL 285


>gi|228477567|ref|ZP_04062200.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus salivarius SK126]
 gi|228250711|gb|EEK09909.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus salivarius SK126]
          Length = 277

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 128/230 (55%), Gaps = 14/230 (6%)

Query: 37  FLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKR 96
            L +A  +  KH+    ILG+ DF+ +R  +      PRPETE LVD  LA + P  E  
Sbjct: 54  LLAHAFSQLKKHKPAQYILGYEDFHGLRFQVDERVLIPRPETEELVDLILAEN-PSTE-- 110

Query: 97  DVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSD 156
             +++LD+GTG+GA+ ++L K  P ++    D+S  A+E+A+ NA  N V+  F  +QSD
Sbjct: 111 --LKVLDIGTGSGAISVSLKKSRPLWQVTASDLSVDAIELAQENAKLNQVAISF--VQSD 166

Query: 157 WFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            F ++ G FD+IVSNPPYI     + +G+ V   +P+++L    +GL+ YR I +   ++
Sbjct: 167 VFENISGSFDIIVSNPPYISENDKNEVGINVLASEPKMALFADEEGLAIYRQIIEEADKY 226

Query: 217 LNKDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           L   G    EIGY Q  D+  +    F  ++   V   KD  G DR+++ 
Sbjct: 227 LTPSGKLYFEIGYKQGQDLKGLLSLHFPDKR---VRVLKDQFGQDRMVVM 273


>gi|296533065|ref|ZP_06895709.1| protein-(glutamine-N5) methyltransferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296266609|gb|EFH12590.1| protein-(glutamine-N5) methyltransferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 287

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 136/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVL--DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           ++   L      S   ++ +P + +  D   RF     + R L HE +  +LG + F+ +
Sbjct: 33  EARLLLAEAMATSQEALLREPRAAVAPDAASRF--AALLQRRLAHEPMAYLLGRQGFWTL 90

Query: 64  RLTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
            L +S DT  PR ++E +V++AL  FS P        R+LDLGTGTG + LA+L E    
Sbjct: 91  ELEVSRDTLIPRADSEAIVEAALEVFSGPG------GRVLDLGTGTGCLLLAVLAERAGA 144

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
            GVGVD+S  A  +A  NA  +G++ R   L  DW +++ G FD+++SNPPYIES +V  
Sbjct: 145 FGVGVDLSPGAAALAARNAARSGLAGRAAFLAGDWDAALAGRFDLVLSNPPYIESAVVPG 204

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EV   +P  +LDGG DGL  YR I   + R L   G   +E+G  Q   V  +  + 
Sbjct: 205 LMPEVAGHEPARALDGGADGLDAYRVIVAALPRLLAPGGHAVLELGQGQAPAVSALAAAA 264

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
            L       D GG +R L+  
Sbjct: 265 GLASRGLRADLGGVERALVLA 285


>gi|90581728|ref|ZP_01237515.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Vibrio angustum S14]
 gi|90437082|gb|EAS62286.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Vibrio angustum S14]
          Length = 284

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   LC V       ++  P+  LDD Q       + R L  E I  I+G R+F+++ L
Sbjct: 27  DSAVLLCHVLDKPRSYLLTWPEKQLDDEQYNIFQQLLARRLNGEPIAYIVGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+     +L +I      ++LDLGTGTGA+ LA+  E P  +  
Sbjct: 87  KVSPSTLIPRPDTERLVE----LALDKITSA-TTKVLDLGTGTGAIALAIASECPSVQVT 141

Query: 126 GVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDC 182
           G+D+  +A E+A  N+    + + RF  L   W+S ++   +F++IVSNPPYI+      
Sbjct: 142 GIDLRQEAAELAHENSQRLSILNTRF--LAGSWYSPLQNNDVFELIVSNPPYIDHADPHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +  +VR F+P+ +L    +GL+  R I+    +HL   G   +E G+ Q + V  I E  
Sbjct: 200 VQGDVR-FEPKSALVADDNGLADIRIISAQGRKHLTVGGWLLMEHGFEQGLAVRTILEQL 258

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V+  +DY G DRV + C
Sbjct: 259 GYQQVSTSQDYAGLDRVTMGC 279


>gi|256845603|ref|ZP_05551061.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Fusobacterium sp. 3_1_36A2]
 gi|256719162|gb|EEU32717.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Fusobacterium sp. 3_1_36A2]
          Length = 383

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 128/222 (57%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+E+A  N   N + E  + ++SD F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSVTGIDINEKAIELANENKTLNKI-ENVNFIKSDLFEKI 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR ++     +L  
Sbjct: 259 DKDFKYDLIVSNPPYISKNEYETLMSEVKNYEPQNALTDLGDGLYFYREMSKLAGEYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
               + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 319 TAYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 360


>gi|206891037|ref|YP_002248217.1| HemK family protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742975|gb|ACI22032.1| HemK family protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 279

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 139/267 (52%), Gaps = 15/267 (5%)

Query: 4   LRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           +R++   +C V  +   Q+  +   +  + Q   + + I R LK E +  I+G   FYN+
Sbjct: 18  IREAQEIICHVLKIDKIQLYTENPEITSE-QAHTIKSLIERRLKKEPLQYIIGECYFYNI 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV-----RILDLGTGTGAVCLALLKE 118
           ++ +      PRPETE+LV+  L       E++ ++     RILDL TG+G + LA+ K 
Sbjct: 77  KIKVGRGVLIPRPETEILVEQVL-------ERQKLISNTGNRILDLCTGSGCIALAIGKN 129

Query: 119 SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIES 177
           +P F+  G+D S KA++ A  N   N +      L  D F+   E +F  I +NPPY+++
Sbjct: 130 APEFQIFGIDKSEKAVKYATENKALNNIKNVI-FLVGDMFNPFKEKIFACITANPPYVKT 188

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
             +  L  E+++++P  +L+GG DGL+ YR I +   ++L   GL  +EIG  Q   V  
Sbjct: 189 DEISKLQPEIKNYEPLEALNGGEDGLNFYRKIIENAEKYLLNSGLIFLEIGQGQAKAVQN 248

Query: 238 IFESRKLFLVNAFKDYGGNDRVLLFCR 264
           I       ++   KD  G DRV++  +
Sbjct: 249 IALMSGFNVIEVVKDIAGIDRVMILQK 275


>gi|330445231|ref|ZP_08308883.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489422|dbj|GAA03380.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 284

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 135/261 (51%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   LC V       ++  P+  LDD Q       + R +  E +  I+G R+F+++ L
Sbjct: 27  DSAVLLCHVLDKPRSYLLTWPEKQLDDAQYEAFQALLTRRINGEPVAYIIGEREFWSLSL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+     +L +I      ++LDLGTGTGA+ LA+  E P  +  
Sbjct: 87  KVSPSTLIPRPDTERLVE----LALEKISA-SATKVLDLGTGTGAIALAIASECPMLQVT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDC 182
           G+D+  +A ++A  N+    +S  RF  L   W+S ++    FDVIVSNPPYI+      
Sbjct: 142 GIDLRQEAADLALENSQRLSISNTRF--LAGSWYSPLQQNETFDVIVSNPPYIDEADPHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +  +VR F+P+ +L    +GL+  R I+D   +HL   G   +E G+ Q   V  I    
Sbjct: 200 VQGDVR-FEPKSALVADDNGLADIRIISDQGRQHLAIGGWLLMEHGFEQGSAVREILAQL 258

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V+  +DY G DRV + C
Sbjct: 259 GYQQVSTSQDYAGLDRVTMGC 279


>gi|238917366|ref|YP_002930883.1| HemK protein [Eubacterium eligens ATCC 27750]
 gi|238872726|gb|ACR72436.1| HemK protein [Eubacterium eligens ATCC 27750]
          Length = 279

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 130/262 (49%), Gaps = 9/262 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
            A  DS   L  + G++    +++ DS+L +         I +   H  +  ILG   FY
Sbjct: 22  NAEHDSFELLSAINGMTRTFYLINGDSLLSEENFLMFEEYIEQRASHIPLQHILGKTWFY 81

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
                ++SD   PR +TE+LV   +  +      R    ILD+ TG+G + + L K+ P 
Sbjct: 82  GYEYMVNSDVLIPRQDTEILVGEVIKVT------RSGDYILDMCTGSGCIGITLAKKFPE 135

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVI 179
            + +GVD+S KAL +A+SN   N  +E  D ++SD F  +     F+ IVSNPPYI + +
Sbjct: 136 CRVLGVDVSEKALNVAQSNK-HNLEAENIDFMRSDLFEELNHDITFNTIVSNPPYIPTKV 194

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           ++ L  EVR  DP ++LDG  DGL  YR I       L  DG    EIG  Q  DV  I 
Sbjct: 195 IEGLQEEVRLHDPILALDGMEDGLMFYRKITAQAGDFLETDGYLCYEIGAEQAADVSDIM 254

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
           +      +   KD  G DRV++
Sbjct: 255 KKAGFKDITVVKDLAGFDRVVM 276


>gi|323698088|ref|ZP_08110000.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfovibrio sp. ND132]
 gi|323458020|gb|EGB13885.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfovibrio desulfuricans ND132]
          Length = 283

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 127/248 (51%), Gaps = 7/248 (2%)

Query: 16  GLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPR 75
           G S   + +D   VL D +   +   + R    E +  ILG R+FY +   +S     PR
Sbjct: 35  GCSRPALNLDRGRVLTDEELAAVETLVARREAGEPVAYILGNREFYGLDFAVSPAVLIPR 94

Query: 76  PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALE 135
           PETE +V++       R  K    R  DLGTG+G + + +    P  +GV VDIS  AL+
Sbjct: 95  PETEHIVEAVEE----RFSKDQPFRFADLGTGSGILAVTIAVLFPQARGVAVDISPDALD 150

Query: 136 IAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRI 194
           +A++NA T+ V++R D LQ+D+ S   EG +D++VSNPPY+     +    EV  F+P  
Sbjct: 151 VARANARTHNVADRLDFLQADFTSQTPEGPYDLVVSNPPYVTEAEFEAASREVTGFEPTG 210

Query: 195 SLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF--ESRKLFLVNAFKD 252
           +L  G DGL H R +   V+  L   G   +EIG+ Q   V+ I   E      V   KD
Sbjct: 211 ALVSGPDGLDHIRAMLPRVADMLRPGGWMFMEIGWEQGCAVMNILAGEYPSFEAVGVRKD 270

Query: 253 YGGNDRVL 260
             G DRV+
Sbjct: 271 LAGLDRVV 278


>gi|89073092|ref|ZP_01159631.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Photobacterium sp. SKA34]
 gi|89051045|gb|EAR56502.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Photobacterium sp. SKA34]
          Length = 284

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   LC V       ++  P+  LDD Q       + R L  E I  I+G R+F+++ L
Sbjct: 27  DSAVLLCHVLDKPRSYLLTWPEKQLDDEQYNIFQQVLARRLNGEPIAYIVGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+     +L +I      ++LDLGTGTGA+ LA+  E P  +  
Sbjct: 87  KVSPSTLIPRPDTERLVE----LALDKITSA-TSKVLDLGTGTGAIALAIASEYPSLQVT 141

Query: 126 GVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDC 182
           G+D+  +A E+A  N+    + + RF  L   W+S ++   +F++IVSNPPYI+      
Sbjct: 142 GIDLRQEAAELAHENSQRLSILNTRF--LAGSWYSPLQHNDVFELIVSNPPYIDHADPHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +  +VR F+P+ +L    +GL+  R I+    +HL   G   +E G+ Q + V  I E  
Sbjct: 200 VQGDVR-FEPKSALVADDNGLADIRIISAQGRKHLTVGGWLLMEHGFEQGLAVRTILEQL 258

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V+  +DY G DRV + C
Sbjct: 259 GYQQVSTSQDYAGLDRVTMGC 279


>gi|167627297|ref|YP_001677797.1| HemK family modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597298|gb|ABZ87296.1| modification methylase, HemK family [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 285

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/258 (33%), Positives = 138/258 (53%), Gaps = 12/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V G+    + ++ D  LD+     +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLGVDKTYLYLNSDKHLDNAILTKINGKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE +V    A  L  I+ ++  ++ILDLGTG+GA+ LAL +E P  +
Sbjct: 86  LYVTKDTLIPRADTEAVV----AAVLDDIQDKNAQLKILDLGTGSGAIALALAEELPKSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
            V VD+  K L++AK NA+ N +    + +QS W+ +++   FD+IVSNPPYI+   VD 
Sbjct: 142 VVAVDLYSKTLDVAKKNALANKIV-NVEFMQSSWYENLDATKFDIIVSNPPYID---VDD 197

Query: 183 LGLE--VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             ++  VR+ +P  +L    +GL+  R I    S  L + G   +E G+ Q  D+  IF 
Sbjct: 198 ANIDDSVREHEPSKALFAADNGLADIRIIISQASGFLKQGGYLYIEHGFTQANDIANIFS 257

Query: 241 SRKLFLVNAFKDYGGNDR 258
                 +   KD    DR
Sbjct: 258 HYSFGDIQTIKDLNHKDR 275


>gi|302342175|ref|YP_003806704.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfarculus baarsii DSM 2075]
 gi|301638788|gb|ADK84110.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfarculus baarsii DSM 2075]
          Length = 291

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 128/255 (50%), Gaps = 8/255 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L +V GL    + +D D  L   +       ++R   HE +  I G R+F+ + L +  
Sbjct: 33  LLSQVLGLERIGLYLDFDRPLTKDELAGFKALLLRRRAHEPVAYIRGKREFFGLELAVGP 92

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
               PRPETELLV+  +A     + + +  +ILDL TG GAV LAL  + P  + +  DI
Sbjct: 93  GVLIPRPETELLVERGVAL----LAQAERPKILDLCTGGGAVALALASQLPTARVLACDI 148

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE---GLFDVIVSNPPYIESVIVDCLGLE 186
           S +AL  A+ NA   G+ ER   LQ   +  V    G FD+I +NPPY+ S    CL  +
Sbjct: 149 SAQALAYARQNAQALGLEERVSFLQGPLWEPVAATGGFFDLITANPPYVTSGEWPCLPPD 208

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF- 245
           VRD +PR++L+ G +GL     I  G    L       VEIG  Q   V+ + ++  +F 
Sbjct: 209 VRDHEPRLALEAGPEGLDVIGPIIVGSRAFLRPLAWLLVEIGAGQGPAVMALAQAAGIFS 268

Query: 246 LVNAFKDYGGNDRVL 260
            +   +D  G DRVL
Sbjct: 269 RIELLRDLAGMDRVL 283


>gi|156973550|ref|YP_001444457.1| hypothetical protein VIBHAR_01251 [Vibrio harveyi ATCC BAA-1116]
 gi|156525144|gb|ABU70230.1| hypothetical protein VIBHAR_01251 [Vibrio harveyi ATCC BAA-1116]
          Length = 285

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+    + +VR +  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEAEQQAQFDDLLVRRIAGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ LAL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTY-----EQTGPILDLGTGTGAIALALASEMPKRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSS-VEGL-FDVIVSNPPYIESVIVDC 182
           GVD+  +A E+A+ NA    +    FD  Q  WF   V G  F +IVSNPPYI+      
Sbjct: 144 GVDLKQEAKELAEYNASQLNIKNVTFD--QGSWFEPIVSGTKFALIVSNPPYIDEQDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P+ +L    +GL+  R I+D   ++L + G  + E GY+Q   V  I  + 
Sbjct: 202 SQGDVR-FEPKSALVADENGLADIRHISDLARQYLEEGGWLAFEHGYDQGDAVREIMTNF 260

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V    DYGGN+RV L C
Sbjct: 261 GYEQVVTENDYGGNERVTLGC 281


>gi|218783032|ref|YP_002434350.1| modification methylase, HemK family [Desulfatibacillum alkenivorans
           AK-01]
 gi|218764416|gb|ACL06882.1| modification methylase, HemK family [Desulfatibacillum alkenivorans
           AK-01]
          Length = 289

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/230 (36%), Positives = 124/230 (53%), Gaps = 16/230 (6%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL----AFSLPRIEKRD 97
           + R    E +  I+G RDF+ + L ++     PRPETE LV++AL    A   P      
Sbjct: 66  VKRRAAREPVAYIVGNRDFWTLELDVNPSVLIPRPETETLVETALEVLNAAQAP------ 119

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
            +R+LDLGTG+GA+ LAL  E P    + VD S +ALE AK+NA  + ++   D  +  W
Sbjct: 120 -MRVLDLGTGSGAIILALASEKPEHHYMAVDYSPQALETAKANAQKHNLN--VDFYKGSW 176

Query: 158 FSSVEGL--FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR 215
           F +V  L  FD++VSNPPYI S  +  L  EV  ++P  +LDGG  G+ H   I +    
Sbjct: 177 FEAVRCLDRFDLVVSNPPYIPSRDIPGLMPEVARYEPMSALDGGPQGMDHLALIIERAPE 236

Query: 216 HLNKDGLCSVEIGYNQKVDVVRI-FESRKLFLVNAFKDYGGNDRVLLFCR 264
           HL   G   +E+G++QK  V ++  E++    V   +D  G+ R  +  R
Sbjct: 237 HLKPGGWLMLEMGFDQKELVEQVALETQAYENVRFVRDLAGHFRTAVMQR 286


>gi|294785108|ref|ZP_06750396.1| methyltransferase [Fusobacterium sp. 3_1_27]
 gi|294486822|gb|EFG34184.1| methyltransferase [Fusobacterium sp. 3_1_27]
          Length = 383

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+E+A  N   N + +  + ++S+ F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSVTGIDINEKAIELANENKTLNKI-KNINFVKSNLFEKI 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 259 DKDFKYDLIVSNPPYISKNEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 319 TGYLAYEIGYNQAKDVTKILQNNNFDVLSVIKDYGGNDRVII 360


>gi|237740337|ref|ZP_04570818.1| methyltransferase [Fusobacterium sp. 2_1_31]
 gi|229422354|gb|EEO37401.1| methyltransferase [Fusobacterium sp. 2_1_31]
          Length = 369

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 126/222 (56%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+   + +  ILG  +FY +   +  +   PRP+TE+LV+  +   +  IE+ +   I
Sbjct: 131 MLRAKSRKPLQYILGEWEFYGLPFKVRENVLIPRPDTEILVEQCIQL-MREIEEPN---I 186

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+  A+ +A  N V N V E  + ++SD F  +
Sbjct: 187 LDIGSGSGAISIAIANELKSSSVTGLDINEDAIRLANENKVLNKV-ENVNFMKSDLFEKL 245

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++F+P+ +L    DGL  YR I+     +L  
Sbjct: 246 DEDFKYDLIVSNPPYITKEEYETLMPEVKNFEPKNALTDLGDGLHFYREISKKAESYLKD 305

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGY Q  +V +I E     +++  KDYGGNDRV+L
Sbjct: 306 TGYLAFEIGYKQAKEVSKILEDNNFAILSVVKDYGGNDRVVL 347


>gi|21672455|ref|NP_660522.1| hypothetical protein BUsg166 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25090515|sp|Q8K9W9|HEMK_BUCAP RecName: Full=Protein methyltransferase hemK homolog
 gi|21623069|gb|AAM67733.1| HemK [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 275

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 135/254 (53%), Gaps = 7/254 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L  V   +   +I++ +  L   Q   L N I R    E I  I+G ++F+++ L
Sbjct: 23  EAEILLSHVLKCTRIAIIINQEIDLSKEQYQKLNNFIYRRSIGEPIAYIIGKKEFWSLSL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE+LV+  L+    ++ K +   ILDLGTG+GA+ LAL      +  +
Sbjct: 83  CVSYKTLIPRPDTEILVEKILS----KVNK-NFRSILDLGTGSGAIALALASVCSHWNII 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVD S  AL+IAK N +   + +  +   S+WFS +   F +IVSNPPYI    +  L  
Sbjct: 138 GVDNSYSALKIAKINGLKLNL-KNVEFFYSNWFSHINEKFHIIVSNPPYIGIKEIQSLKK 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           ++  ++P  +L    DGL     I    S++L   G   +E G+ QK+ V   F+    F
Sbjct: 197 DIF-YEPFNALISKKDGLLDIELIIQKASQYLFDKGWLFIEHGWKQKLKVQYFFKKYNFF 255

Query: 246 LVNAFKDYGGNDRV 259
            + +FKDYGGNDR+
Sbjct: 256 CIQSFKDYGGNDRI 269


>gi|85711947|ref|ZP_01043001.1| HemK [Idiomarina baltica OS145]
 gi|85694133|gb|EAQ32077.1| HemK [Idiomarina baltica OS145]
          Length = 282

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 128/236 (54%), Gaps = 10/236 (4%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L D Q   L N + R  + E +  I+G R+F+++ L +   T  PRP+TE LV++A
Sbjct: 48  PERRLTDAQFQQLQNWVARRCRGEPVAYIVGEREFWSLSLAVDKSTLIPRPDTECLVETA 107

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L+ SLP        R+LDLGTGTGA+ LAL  E P ++   VD S  A+ +A+ NA   G
Sbjct: 108 LSLSLPAD-----ARVLDLGTGTGAIALALKSERPDWQVTAVDWSASAVSLAQRNARRLG 162

Query: 146 VSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGL 203
           ++   + L S WF S+    ++D+IVSNPPYI          +VR F+PR +L     G+
Sbjct: 163 LA--VEVLHSHWFDSLADRSVYDLIVSNPPYIAEDDAHLAQGDVR-FEPRSALVAERAGI 219

Query: 204 SHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
           +    IA+    +L  +G   +E G+ Q   V+ +        VN ++DYG  +R+
Sbjct: 220 ADLHHIAEQGHAYLKPNGWLLMEHGWQQAQAVITLLREFGYKNVNIWRDYGNVERI 275


>gi|78484733|ref|YP_390658.1| HemK family modification methylase [Thiomicrospira crunogena XCL-2]
 gi|78363019|gb|ABB40984.1| modification methylase, HemK family [Thiomicrospira crunogena
           XCL-2]
          Length = 279

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 124/240 (51%), Gaps = 9/240 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P S  +  Q F LT+   R ++   I  ++G R+F+ +   ++ DT  PRP+TE+LV++A
Sbjct: 48  PLSEAEHTQYFDLTS---RRVEGHPIAHLIGHREFWGMDFQVTPDTLIPRPDTEILVETA 104

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L     +         LDLGTG+GA+  A+    P  +   VD    AL +A+ NA  + 
Sbjct: 105 LEIMASK--NNQAWSFLDLGTGSGAIACAIKASHPACEATAVDFQASALAVAQQNANQHH 162

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++  F   Q  WF  V+G  FD+IVSNPPYIE         +VR F+P  +L  G DGL 
Sbjct: 163 LTIHFK--QGSWFDPVKGQTFDLIVSNPPYIEEHDPHLKEGDVR-FEPLTALTSGEDGLD 219

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             R I +    +L   G   +E GYNQ   V R+F+++    V +  DYG N RV L  R
Sbjct: 220 DIRFIIEHAPTYLKPKGWLLIEHGYNQHEAVQRLFKAQGFTAVESRLDYGQNPRVTLGQR 279


>gi|227513056|ref|ZP_03943105.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus buchneri ATCC 11577]
 gi|227524271|ref|ZP_03954320.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus hilgardii ATCC 8290]
 gi|227083631|gb|EEI18943.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus buchneri ATCC 11577]
 gi|227088502|gb|EEI23814.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus hilgardii ATCC 8290]
          Length = 288

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 136/246 (55%), Gaps = 5/246 (2%)

Query: 16  GLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPR 75
           G S+  +++     +   Q     N + R +  E +  I+G  +FY + L + S+   PR
Sbjct: 40  GFSTTDMLIHYHDKMLSGQWLQFQNDVKRLISGEPVQYIVGQANFYGLTLNVDSNVLIPR 99

Query: 76  PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALE 135
            ETE LVD  L      +     +++LD+GTG+GA+ +AL    P ++    DIS  AL+
Sbjct: 100 VETEELVDWIL--DQTTVYTNRPLKVLDIGTGSGAIAIALKANRPEWQVNASDISESALK 157

Query: 136 IAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRIS 195
           +A+ NA  + V+  F  + SD F+ +   FD+IVSNPPYI +  V  +   V++ +PRI+
Sbjct: 158 VAQQNAQLHHVAINF--ILSDMFAHINEAFDLIVSNPPYISASEVGDMDSSVKNNEPRIA 215

Query: 196 LDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYG 254
           L    DGL+ Y+++A GV  HLN  G   VEIG++Q+  V +IF E+    +V A  D  
Sbjct: 216 LFAADDGLAIYKSLAKGVDAHLNVGGQLFVEIGFHQETSVRKIFQEALPNAIVTAKHDVS 275

Query: 255 GNDRVL 260
           G+ R++
Sbjct: 276 GHQRMV 281


>gi|146283508|ref|YP_001173661.1| methyl transferase [Pseudomonas stutzeri A1501]
 gi|145571713|gb|ABP80819.1| methyl transferase [Pseudomonas stutzeri A1501]
          Length = 275

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 126/221 (57%), Gaps = 8/221 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R  + E +  ILG + F+++ L +++DT  PRP+TELLV++AL     ++      R+
Sbjct: 58  LARRRQGEPVAYILGRQGFWSLELEVAADTLIPRPDTELLVETAL-----QLLSAAPARV 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTGTGA+ LAL  E P ++  GVD    A+ +A+ N +  G+     TL SDWF+ +
Sbjct: 113 LDLGTGTGAIALALATERPAWQVCGVDRVEAAVRLAERNRLRLGLHNAAFTL-SDWFAGL 171

Query: 162 EG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            G  F +IVSNPPYI +     L  +VR F+P+ +L  G DGL   RTI    + HL   
Sbjct: 172 NGERFQMIVSNPPYIPASDPHLLQGDVR-FEPQSALIAGADGLDDIRTIIAQAAAHLQSG 230

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E GY+Q   V  +  SR    V +  D GG++R+ L
Sbjct: 231 GWLLLEHGYDQAEAVRMLLLSRGFEDVQSRLDLGGHERISL 271


>gi|83644570|ref|YP_433005.1| methylase of polypeptide chain release factors [Hahella chejuensis
           KCTC 2396]
 gi|83632613|gb|ABC28580.1| Methylase of polypeptide chain release factors [Hahella chejuensis
           KCTC 2396]
          Length = 276

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 140/262 (53%), Gaps = 18/262 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR-----QRFFLTNAIVRSLKHESIHRILGWRDF 60
           D+   L  V G     +I   DSVLD+      QR        R + H     ++G R+F
Sbjct: 22  DAEVLLAHVLGKGRTYLISHNDSVLDEPALQAYQRLIAERETGRPVAH-----LIGKREF 76

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           +++   +S  T  PRPETELLV+  L  + P   K     +LDLGTGTGA+  AL  E P
Sbjct: 77  WSLEFQVSPATLIPRPETELLVELVLEEAAPAGAK-----VLDLGTGTGAIACALAHERP 131

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVI 179
            ++   VD+S +A+E+A +N ++ G++     L+S+W+ +V +  F VIVSNPPYI+++ 
Sbjct: 132 DWRFTAVDVSQEAVELATTNVLSLGLTN-VRCLRSNWYDAVGDEQFHVIVSNPPYIDALD 190

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           +     +VR F+P  +L     GL+  R IA G  RHL   GL +VE GY+Q      IF
Sbjct: 191 IHLTQGDVR-FEPASALVAADHGLADIRMIAAGAGRHLLAGGLLAVEHGYDQGAAAREIF 249

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
            +     V   +D  G+DR+ L
Sbjct: 250 STAGYVDVRTHQDLAGHDRITL 271


>gi|284007354|emb|CBA72731.1| protein methyltransferase (protein-glutamine N-methyltransferase)
           [Arsenophonus nasoniae]
          Length = 256

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 140/247 (56%), Gaps = 7/247 (2%)

Query: 14  VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           +TG +   +I   ++ L  +Q+  L + +VR  + E I  ++  ++F+++ + +SS T  
Sbjct: 4   ITGKTRTFLIAFGETELSVKQQQQLEHLLVRRARGEPIAYLVEEKEFWSLPIKVSSVTLI 63

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PRP+TE LV+ AL      +  +  V+ILDLGTGTGAV LAL  E P  + VGVDIS  A
Sbjct: 64  PRPDTECLVERALQL----LSDKRAVKILDLGTGTGAVALALASECPQAQIVGVDISDAA 119

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCLGLEVRDFDP 192
           + +A+ NA  N +       +S+WF+S+    FD+IVSNPPYI+         +VR F+P
Sbjct: 120 ITLAQLNA-DNLLINNVKFCKSNWFTSLPIQQFDMIVSNPPYIDECDPHLQQGDVR-FEP 177

Query: 193 RISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKD 252
           + +L     GL+  + I +  + +L  +G   +E G+ Q   V ++F       V  F+D
Sbjct: 178 KTALISANHGLADIQLIIEQSANYLANNGWLLLEHGWLQGRQVRQLFSCHHYQQVVTFQD 237

Query: 253 YGGNDRV 259
           YGGNDR+
Sbjct: 238 YGGNDRI 244


>gi|289765719|ref|ZP_06525097.1| methyltransferase [Fusobacterium sp. D11]
 gi|289717274|gb|EFD81286.1| methyltransferase [Fusobacterium sp. D11]
          Length = 370

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 130/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   ++     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 131 VLRAKKRKPLQYILGEWEFYGLPFKVNEGVLIPRADTEILVEQCIQL-MREVEEPN---I 186

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+++A  N + N + E  + ++S+ F  +
Sbjct: 187 LDIGSGSGAISIAIANELKSSSITGIDINEKAIKLANENKILNKI-ENVNFIESNLFEKL 245

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 246 DKDFKYDLIVSNPPYISKEEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 305

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 306 TGYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 347


>gi|290475216|ref|YP_003468102.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Xenorhabdus bovienii SS-2004]
 gi|289174535|emb|CBJ81329.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Xenorhabdus bovienii SS-2004]
          Length = 286

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 91/262 (34%), Positives = 143/262 (54%), Gaps = 12/262 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   ++++   +   L + + R ++ E +  I+G R+F+++ 
Sbjct: 22  RDAEILLGYVTGRSRTYLIAFDETLISSEELHQLDSLLGRRIQGEPVAYIIGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
             +S  T  PRP+TE LV+ AL   LP        RILDLGTGTGA+ LAL  E      
Sbjct: 82  FAVSPATLIPRPDTECLVEKALEL-LP----DSPARILDLGTGTGAIALALASERNDCYV 136

Query: 125 VGVDISCKALEIAKSNAVTNG---VSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIV 180
            GVDI+  A+ +A+ NA  N         + LQS+WF++V    FD+IVSNPPYI+    
Sbjct: 137 TGVDINSDAVMLAQYNAEKNAGKLAIHNVNFLQSEWFAAVGNQQFDMIVSNPPYIDECDP 196

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH-LNKDGLCSVEIGYNQKVDVVRIF 239
                ++R F+P  +L    +G++  + I  G +RH L+ +G   +E G+ Q + V  +F
Sbjct: 197 HLQEGDIR-FEPATALIAAQNGMADLQAIV-GQARHFLSPNGWLLLEHGWKQGIVVRNLF 254

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
             +    +  F+DYGGN+R+ +
Sbjct: 255 LEKGYQQIATFQDYGGNERITI 276


>gi|332184656|gb|AEE26910.1| modification methylase, HemK family [Francisella cf. novicida 3523]
          Length = 284

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 138/256 (53%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V  +    + ++ D  LD      +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLDVDKTYLCINSDRRLDKNTLKEIDEKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PR +TE+LV + L      ++K   ++ILDLGTGTGA+ LAL  E    + 
Sbjct: 86  LYVTKDTLIPRADTEVLVSTVLD---DIVDKNAKLKILDLGTGTGAIGLALAAELVNSQI 142

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDC 182
           V VD+  ++L++AK+NA  N ++  +F  +QS W++S++ G FD+IVSNPPYI+    + 
Sbjct: 143 VAVDLYQQSLDVAKNNAQANNITNVKF--IQSSWYTSLDTGKFDIIVSNPPYIDLADTN- 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +   V++++P  +L    +GL+  + I       LN  GL  +E G+ Q   V  +F   
Sbjct: 200 IEQSVKEYEPARALFAADNGLADIKEIISQAKNFLNPGGLVYIEHGFTQADAVTALFSQY 259

Query: 243 KLFLVNAFKDYGGNDR 258
               +   KD   NDR
Sbjct: 260 NFTDIKTVKDLNNNDR 275


>gi|256027763|ref|ZP_05441597.1| methyltransferase [Fusobacterium sp. D11]
          Length = 383

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 130/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   ++     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKVNEGVLIPRADTEILVEQCIQL-MREVEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+++A  N + N + E  + ++S+ F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSITGIDINEKAIKLANENKILNKI-ENVNFIESNLFEKL 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 259 DKDFKYDLIVSNPPYISKEEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 319 TGYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 360


>gi|168203425|gb|ACA21560.1| HemK [Candidatus Pelagibacter ubique]
          Length = 280

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 146/262 (55%), Gaps = 4/262 (1%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  DS   L  V   +   +I++ +  ++    +     + +  K + +  ++G +DF+N
Sbjct: 22  AQLDSEILLAEVINKNREYIILNQNHTVNKESYYQFKTLVEQRSKGKPVAYLVGKKDFWN 81

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
            +  ++     PRP+TE++V+  L  +    + +  + ILD+G G+G + L++LKE    
Sbjct: 82  YQFQINEHVLIPRPDTEIIVEQVLKIT----KFKSNLMILDIGVGSGCILLSVLKEKKNS 137

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +G+G+D+S K++EI+K NA+  G+  R    ++D  +   G +D+I+SNPPYI  + +  
Sbjct: 138 RGIGIDLSKKSVEISKLNALNLGLLNRLKIFKTDVDNFNFGKYDLIISNPPYINKLDLKY 197

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +V +F+P I+LDGG++G+S    + +  S  + K G   +EI +NQ+  V ++  ++
Sbjct: 198 LDKDVINFEPNIALDGGLEGISVISKVINKSSELIKKKGKLILEISFNQREKVKKLLINK 257

Query: 243 KLFLVNAFKDYGGNDRVLLFCR 264
             ++    KDY  NDR ++  +
Sbjct: 258 GFYINKILKDYAKNDRCIISTK 279


>gi|188534014|ref|YP_001907811.1| Protein methyltransferase [Erwinia tasmaniensis Et1/99]
 gi|188029056|emb|CAO96924.1| Protein methyltransferase [Erwinia tasmaniensis Et1/99]
          Length = 281

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 138/256 (53%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   D  LD      L   +VR    E I  + G R+F+++ 
Sbjct: 22  RDAEILLGLVTGKSRAWLIGFDDHELDAATLKRLDALLVRRAAGEPIAYLTGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP++E+LV+ ALA  LP         +LDLGTG+GA+ LAL  E    + 
Sbjct: 82  LCVTPDTLIPRPDSEVLVEQALAH-LP----GGPCSVLDLGTGSGAIALALASERADCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +GVD    A+ +A+ NA   G++     +Q DWFS++ +  F +IVSNPPYI++      
Sbjct: 137 LGVDRIPAAVALAQHNAARLGLAN-ATFMQGDWFSALNQQRFAMIVSNPPYIDAADEHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+  + IA    R+L   G   +E G+ Q  D+ +I   + 
Sbjct: 196 QGDVR-FEPASALVAGDSGLADIKIIAAQAGRYLVNQGWLLLEHGWQQGEDIRQILADKG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              ++  +DYGGNDRV
Sbjct: 255 FCQISTRQDYGGNDRV 270


>gi|291520819|emb|CBK79112.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Coprococcus catus GD/7]
          Length = 289

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 138/258 (53%), Gaps = 10/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIV---DPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           D+   L  + G+S    ++   DP      +Q       I R  +   +  ++G  +F  
Sbjct: 28  DAWYLLEHIYGISRVDFLIRRNDPFDEAQMKQSADYQALIRRRSEGYPVQYLMGSTEFMG 87

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +   ++     PR +TE+LV++ALA   P        R+LD+ TG+G + L+L K     
Sbjct: 88  LPFFVNESVLIPRQDTEVLVETALAMMKPE------CRLLDMCTGSGCILLSLAKLGTVA 141

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +GVGVDIS  AL++A+ N    G+S+    + SD F SVEG+FD+IVSNPPYI +  ++ 
Sbjct: 142 EGVGVDISEGALKVAERNRENLGLSQ-VKLVHSDLFGSVEGVFDMIVSNPPYIPTNDIED 200

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EV+D +P ++LDG  DGL  YR +A+   R+L   G    EIGY+Q   V ++ +  
Sbjct: 201 LMREVKDHEPHLALDGSRDGLLFYRKLAEESGRYLVPGGSLLFEIGYDQGKAVSQLLDQA 260

Query: 243 KLFLVNAFKDYGGNDRVL 260
               ++  KD  G DRV+
Sbjct: 261 GFKDIHVKKDLAGLDRVV 278


>gi|157826556|ref|YP_001495620.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia bellii OSU 85-389]
 gi|157801860|gb|ABV78583.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia bellii OSU 85-389]
          Length = 563

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 139/269 (51%), Gaps = 30/269 (11%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++ +P+  L+  +   +   + R LKH+ I  ILG ++FY+    ++     PR +TE+L
Sbjct: 43  LLANPEKQLNQLEIEAVEKVLERRLKHKPIAYILGTKEFYSREFIVNKHVLIPRNDTEIL 102

Query: 82  VDSALAFSLPR--------------------------IEKRDVVR---ILDLGTGTGAVC 112
           +D  L +                              ++ R+ ++   IL+LGTG+G + 
Sbjct: 103 IDVVLQYHSQHFQYHSQHSLCHSSNGGNPDKKQLDSVVKPRNNIKSSNILELGTGSGCIS 162

Query: 113 LALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSN 171
           ++LL E P  +    DIS  A+E+AKSNA+ + V++R   + S+WF ++ +  FD+IVSN
Sbjct: 163 ISLLLELPNSQITATDISIDAIEVAKSNAIKHDVTDRLQIIHSNWFENIGKQKFDLIVSN 222

Query: 172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
           PPYI       + +E  +++P I+L    DGL  Y+ IA+   + L ++G   +EIGY Q
Sbjct: 223 PPYISINEKPEMAIETINYEPSIALFAEEDGLLSYKIIAENAKKFLKQNGKIILEIGYKQ 282

Query: 232 KVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
              V +IF      + N  +D   ++RV+
Sbjct: 283 ADQVSQIFLDHGYVIDNIHQDLQSHNRVI 311


>gi|260598214|ref|YP_003210785.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Cronobacter turicensis z3032]
 gi|260217391|emb|CBA31447.1| Protein methyltransferase hemK [Cronobacter turicensis z3032]
          Length = 280

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 139/258 (53%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L D +   L   + R    E +  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGRTRTFILAFGETALTDDELARLETLLARRAAGEPVAYLIGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S+ T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LA+  E P    
Sbjct: 82  LEVSTATLIPRPDTECLVEQALA-RLPAT----ACRILDLGTGTGAIALAIASERPDCHV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             +D+  +A+E+AK NA   G+ +    LQS WFS++  + F +IVSNPPYI+       
Sbjct: 137 TALDVIPEAVELAKRNAQRLGI-DNVTVLQSHWFSALTDVRFSLIVSNPPYIDGDDPHLT 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L     GL+  +T+  G    L  +G   +E G+ Q   V  +FE   
Sbjct: 196 QGDVR-FEPKSALVAENAGLADLKTLIVGARHFLEDNGGLLLEHGWQQGGAVRELFERAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YQGVETCRDYGGNERLTL 272


>gi|262369774|ref|ZP_06063102.1| methyl transferase [Acinetobacter johnsonii SH046]
 gi|262315842|gb|EEY96881.1| methyl transferase [Acinetobacter johnsonii SH046]
          Length = 272

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 133/258 (51%), Gaps = 10/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  +T + S  +++  D VL D Q      A+ R    E +  + G + F+ + 
Sbjct: 19  QENAWLLEHITKIDSFDLVMKKDQVLTDEQEQAYVAALARIEAGEPLAYVTGSQPFWTLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP+TE+LV++ L   LP     +  RI+DLGTGTGAV L+L  E   +  
Sbjct: 79  LIVTPDTLVPRPDTEVLVETVLRLDLP-----EDARIVDLGTGTGAVALSLACERDTWDI 133

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCL 183
              DI    L +A+ NA  + +++      S WF+ +    FDVIVSNPPYI++   D  
Sbjct: 134 TATDIYEPTLAVAQQNAEKHDLNDVTFVCGS-WFAPLNRKFFDVIVSNPPYIDA---DDA 189

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
            ++    +P  +L     GL+  R I     +HL  DG   +E GY+Q   V +IF+   
Sbjct: 190 HMQDLATEPERALVAADHGLADLRVIIQQGKKHLTLDGWVVLEHGYDQADAVQKIFKEAG 249

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   KDYGGNDRV L
Sbjct: 250 YKQVRTVKDYGGNDRVTL 267


>gi|260494287|ref|ZP_05814418.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Fusobacterium sp. 3_1_33]
 gi|260198433|gb|EEW95949.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Fusobacterium sp. 3_1_33]
          Length = 383

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   ++     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKVNEGVLIPRADTEILVEQCIQL-MREVEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+E+A  N   N + E  + ++S+ F  +
Sbjct: 200 LDIGSGSGAISIAIANELKSSSVTGIDINEKAIELAIENKTLNKI-ENVNFIESNLFEKL 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 259 DKDFKYDLIVSNPPYISKEEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGNDRV++
Sbjct: 319 TGYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVI 360


>gi|283832856|ref|ZP_06352597.1| protein-(glutamine-N5) methyltransferase [Citrobacter youngae ATCC
           29220]
 gi|291071456|gb|EFE09565.1| protein-(glutamine-N5) methyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 277

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 131/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++VL + QR  L   + R  + E +  + G R+F+++ 
Sbjct: 22  RDAEILLEFVTGKGRTFILAFGETVLTEAQREQLATLVARRQRGEPVAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P    
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----ASACRILDLGTGTGAIALALASERPDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  N     + +    LQSDWFS++ G  FD+IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVALAMRNTRHLAI-DNVQVLQSDWFSALSGQQFDMIVSNPPYIDEQDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G +GL+    I D     L   G   +E G+ Q   V   F    
Sbjct: 196 QGDVR-FEPLSALVAGENGLADIVHIIDSSRSVLTPGGYLLLEHGWQQGAAVREAFIRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YLAVETCRDYGGNERITL 272


>gi|311693604|gb|ADP96477.1| modification methylase, HemK family [marine bacterium HP15]
          Length = 283

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 131/257 (50%), Gaps = 9/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  +TGLS       P+  + D         +   +    +  +LG ++F+++ L
Sbjct: 28  DAELLLSHITGLSRTSFRAWPEREVTDTHAEAFERLVQDRVAGRPVAHLLGHQEFWSLPL 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S+ T  PRP+TE LV+ ALA  LPR        +LDLGTGTGA+ LAL  E   ++  
Sbjct: 88  KVSASTLIPRPDTECLVEVALALPLPR-----QASVLDLGTGTGAIALALASEHGGWRIS 142

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLG 184
             D   +A+ +A+ NAV  G++     +QS WFS +E   FD+IVSNPPYI         
Sbjct: 143 ACDAVPEAVALARENAVALGLN--LSVVQSSWFSGLEPERFDLIVSNPPYIPDSDRHLEE 200

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P  +L  G DGL   R I       L + G   VE G++Q   V ++F +R  
Sbjct: 201 GDVR-FEPASALVSGSDGLDDLRLIISQAPDWLFEGGWLLVEHGFDQAEAVAQLFHARGF 259

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   +DYG  DR+ L
Sbjct: 260 KAVETRQDYGNRDRMTL 276


>gi|153814376|ref|ZP_01967044.1| hypothetical protein RUMTOR_00586 [Ruminococcus torques ATCC 27756]
 gi|317500090|ref|ZP_07958325.1| hypothetical protein HMPREF1026_00267 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087686|ref|ZP_08336612.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848772|gb|EDK25690.1| hypothetical protein RUMTOR_00586 [Ruminococcus torques ATCC 27756]
 gi|316898575|gb|EFV20611.1| hypothetical protein HMPREF1026_00267 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409667|gb|EGG89103.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 287

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 132/260 (50%), Gaps = 7/260 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VT +S       P+  L + ++      I R  +   +  I G ++F  +  
Sbjct: 25  DAWYLLEYVTKISRAVFYAYPEKELTEEEKIQYEECIKRRAERIPLQHITGVQEFMGLPF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALL-----KESP 120
            ++     PR +TE+LV+ AL       + +++VRILDL TG+G + L++L     K   
Sbjct: 85  LVNEHVLIPRQDTEVLVEQALCLLEKEKKHKEIVRILDLCTGSGCILLSMLHYVRRKRKI 144

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
              GVG DIS +AL +A  NA   G+  +F  +Q D F +VEG FD+I+SNPPYI +  +
Sbjct: 145 DIYGVGSDISKEALAVAVENAKKLGIEAKF--VQGDLFENVEGSFDMILSNPPYIRTSEI 202

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           + L  EVR  DP  +LDG  DGL  YR I     ++L + G    EIG +Q   V  + +
Sbjct: 203 ERLQEEVRFHDPIKALDGKEDGLYFYRIIVKESRQYLKRGGWLIFEIGSDQAEAVKTLLQ 262

Query: 241 SRKLFLVNAFKDYGGNDRVL 260
                 +   KD  G DRV+
Sbjct: 263 EAGYENIEVKKDLAGLDRVV 282


>gi|56460032|ref|YP_155313.1| hypothetical protein IL0924 [Idiomarina loihiensis L2TR]
 gi|56179042|gb|AAV81764.1| Protoporphyrinogen oxidase [Idiomarina loihiensis L2TR]
          Length = 281

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 135/259 (52%), Gaps = 10/259 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  D  + LC V       ++  P+  L   Q+      I+   K + +  I G R+F++
Sbjct: 20  AAADVSALLCFVLDKEKTYLMTWPEKPLTQEQQRHYEECILARQKGKPVAHITGRREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +++ T  PRP+TE LV++AL+  LP     +  R+LDLGTGTGAV LAL  E P +
Sbjct: 80  LMLEVNASTLIPRPDTETLVEAALSLELP-----ENARVLDLGTGTGAVALALKSERPGW 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIV 180
           +    D S  A+E+A+ N+   G++   + L S+WF SV     FD+I+SNPPYI++   
Sbjct: 135 QVWACDKSGDAVELARRNSQALGLN--VEILCSNWFQSVPKSLKFDLILSNPPYIDAGDP 192

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P+ +L    +GL+   TI    + HL   G   +E G+ Q   V  +  
Sbjct: 193 HLSMGDVR-FEPQTALIAENNGLADIETIIKEANNHLADQGWLLLEQGWQQADSVAELLF 251

Query: 241 SRKLFLVNAFKDYGGNDRV 259
                 VN ++DY   DRV
Sbjct: 252 KSGYKKVNRWQDYARVDRV 270


>gi|226952753|ref|ZP_03823217.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Acinetobacter sp. ATCC 27244]
 gi|226836502|gb|EEH68885.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Acinetobacter sp. ATCC 27244]
          Length = 270

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 139/263 (52%), Gaps = 14/263 (5%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  + G++S ++ +  +  L + Q     + + R  + E +  + G + F+ + 
Sbjct: 19  QEAAWLLEHILGVNSLELKLRLEQELTEIQEQAYLDGLARIEQGEPLAYVTGSQPFWTLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSL-PRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PRP+TE+LV++ L  SL P+        I+DLGTGTGA+ LAL  E P + 
Sbjct: 79  LKVTHDTLVPRPDTEILVETVLKLSLDPQ------ANIVDLGTGTGAIALALASERPQWS 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVD 181
               DI    LE+A+ NA+ +G+S+ +F      WF ++E   FD+IVSNPPYI+    D
Sbjct: 133 VTATDIYQPTLEVAQENALKHGLSQVKFAC--GAWFEALEQQQFDLIVSNPPYIDP---D 187

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            + ++    +P  +L     GL+   TI       L  +G  ++E GY+Q   V  IFE 
Sbjct: 188 DVHMQKLKSEPERALIAANHGLADIETIIAQGKDWLKAEGWIALEHGYDQGQVVREIFEQ 247

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
                +   KDYGGNDRV L  +
Sbjct: 248 HGFNQIQTIKDYGGNDRVSLAQK 270


>gi|59711376|ref|YP_204152.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Vibrio fischeri ES114]
 gi|59479477|gb|AAW85264.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Vibrio fischeri ES114]
          Length = 284

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (49%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  P+ ++ D +       + R L  E I  I+G+R+F+++ L
Sbjct: 27  DAAVLLCHVLDKPRSYLLTWPEKIVSDEELGNFNALLERRLAGEPIAYIVGYREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL    P  +      ILDLGTGTGA+ LA+  E P    +
Sbjct: 87  KVSPTTLIPRPDTERLVEVALDHLTPNAQS-----ILDLGTGTGAIALAIASEMPTLNVI 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS--SVEGLFDVIVSNPPYIESVIVDCL 183
           GVD    A+E+AK NA  N ++   +  Q  WF   S+   FD+IVSNPPYI+       
Sbjct: 142 GVDYQDDAVELAKGNAKINHIN-NVEFRQGSWFEPISLSDKFDIIVSNPPYIDGNDPHLS 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +G S    I      +L   G   +E G+ Q   +   FE   
Sbjct: 201 EGDVR-FEPQTALVAEQNGFSDLIHIMQHGREYLLNGGWLMMEHGFEQGEQLRHFFEEHG 259

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DY GNDRV L
Sbjct: 260 YINVKTEQDYAGNDRVTL 277


>gi|168704925|ref|ZP_02737202.1| modification methylase, HemK family protein [Gemmata obscuriglobus
           UQM 2246]
          Length = 291

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 118/232 (50%), Gaps = 7/232 (3%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLP 91
           D +R      I R L    +  ++G R FY +   +      PR +TE LV  AL     
Sbjct: 59  DAERAKYKELITRRLAGWPVAYLVGSRGFYLLNFDVDPAVLIPRSDTETLVGEALK---- 114

Query: 92  RIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFD 151
           R++      +LD+GTG+G + ++L  +         D+S  AL +AK NA+ N V++R  
Sbjct: 115 RLKPLTAPAVLDIGTGSGCIAVSLAHQKKDSHVTATDVSPDALAVAKRNAIKNNVADRMT 174

Query: 152 TLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTI 209
            LQ D F+ +     FD++VSNPPYI       L  +VRD +PR++LDGG DGL+ YR I
Sbjct: 175 FLQGDLFAPLPAGVTFDLVVSNPPYIAQSEFAELAPDVRDHEPRVALDGGPDGLAFYRRI 234

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDV-VRIFESRKLFLVNAFKDYGGNDRVL 260
           A  V   L   G   +EIG+ Q   V   I E  +L L    KD G N RV+
Sbjct: 235 AAAVGPFLKPGGSLLLEIGWKQDAAVRALIAEQPELELGPTIKDMGKNPRVV 286


>gi|296775700|gb|ADH42976.1| polypeptide chain release factor methylase [uncultured SAR11
           cluster alpha proteobacterium H17925_38M03]
          Length = 279

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 132/256 (51%), Gaps = 5/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L +    S  +++V+ +  + D++       + R  ++E I  I+  ++F+  + 
Sbjct: 25  DSEILLSKTLNKSREEILVNLNFEIKDKEILVFNEYLNRRSQNEPIAYIVEEKEFWGEKF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ DT  PRPETELLVD  L     +I     V ILD+GTG+G + L+LL       G+
Sbjct: 85  YVNKDTLIPRPETELLVDKIL-----KIYNGKKVTILDMGTGSGCIILSLLNNLNKSYGI 139

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS +A+ IAK NA    +  +       + +     FD+IVSNPPY+    +  L  
Sbjct: 140 GVDISKRAILIAKKNASRLKILNKVKFFNRPFENIFYKKFDLIVSNPPYVIRKDIKNLSP 199

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           +V+ F+P+I++DGG DGL   + +       L   G+ ++EIG  Q   V +I  +    
Sbjct: 200 DVKKFEPKIAIDGGNDGLDLIKKVIYKSKNILKIKGVLALEIGNEQYKKVSKILVNNSFK 259

Query: 246 LVNAFKDYGGNDRVLL 261
           + N  KDY  N R ++
Sbjct: 260 IKNTIKDYKNNVRCII 275


>gi|332971800|gb|EGK10748.1| protein-(glutamine-N5) methyltransferase [Desmospora sp. 8437]
          Length = 314

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 117/218 (53%), Gaps = 11/218 (5%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG 109
            +  ++G ++FY     +      PRPETE+LV++ L      I K   V  +D+GTG+G
Sbjct: 94  PVQYLIGEQEFYGRSFRVEPSVLIPRPETEILVETVLR-EADGIWKGKAVTAVDMGTGSG 152

Query: 110 AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFD 166
           A+ + L  E P ++ V VD S  AL++A+ N   NG  +R   +Q DW   +   +   D
Sbjct: 153 AIAVTLAAERPAWEVVAVDRSPAALKVARQNGAKNGSGDRIRWMQGDWLEPLLKRDLRVD 212

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           V+VSNPPYI +  +  L +EVRD +PR++LDGG DGL  YR +  G+   L   GL   E
Sbjct: 213 VVVSNPPYIPAGEIPRLDVEVRDHEPRMALDGGPDGLDPYRILVRGIPAVLKNPGLVVFE 272

Query: 227 IGYNQKVDVVRIFESR----KLFLVNAFKDYGGNDRVL 260
           +G +Q   V  + E      ++F V+   D  G  RV+
Sbjct: 273 VGEDQSETVGEMLEESLAGAQVFFVS---DLAGRPRVV 307


>gi|146318503|ref|YP_001198215.1| methylase of polypeptide chain release factors [Streptococcus suis
           05ZYH33]
 gi|146320694|ref|YP_001200405.1| methylase of polypeptide chain release factors [Streptococcus suis
           98HAH33]
 gi|253751629|ref|YP_003024770.1| methyltransferase [Streptococcus suis SC84]
 gi|253753531|ref|YP_003026672.1| methyltransferase [Streptococcus suis P1/7]
 gi|253755644|ref|YP_003028784.1| methyltransferase [Streptococcus suis BM407]
 gi|145689309|gb|ABP89815.1| Methylase of polypeptide chain release factors [Streptococcus suis
           05ZYH33]
 gi|145691500|gb|ABP92005.1| Methylase of polypeptide chain release factors [Streptococcus suis
           98HAH33]
 gi|251815918|emb|CAZ51532.1| putative methyltransferase [Streptococcus suis SC84]
 gi|251818108|emb|CAZ55902.1| putative methyltransferase [Streptococcus suis BM407]
 gi|251819777|emb|CAR45684.1| putative methyltransferase [Streptococcus suis P1/7]
 gi|292558284|gb|ADE31285.1| Modification methylase HemK [Streptococcus suis GZ1]
 gi|319758067|gb|ADV70009.1| methylase of polypeptide chain release factors [Streptococcus suis
           JS14]
          Length = 277

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 121/224 (54%), Gaps = 15/224 (6%)

Query: 40  NAIVRSL-KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV 98
           +AI + L +H     I+G  DF+ +   +      PRPETE LVD  L     +      
Sbjct: 56  DAIFQQLSQHRPAQYIIGKADFHGLEFAVDERVLIPRPETEELVDLIL-----QENSGAS 110

Query: 99  VRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWF 158
           +RILD+GTG+GA+ ++L K  P ++ V VDIS  AL +A+ NA TN VS  F  L+SD  
Sbjct: 111 LRILDIGTGSGAIAISLAKARPDWEVVAVDISNDALAVAQENARTNQVSVHF--LESDVL 168

Query: 159 SSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
            +V G FD+IVSNPPYI     D +GL V   +P ++L    DG++ YR IA+     L 
Sbjct: 169 QAVTGKFDIIVSNPPYISPDDTDEVGLNVLTSEPHLALFAEEDGMAIYRQIAEQAGAFLK 228

Query: 219 KDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDR 258
           ++G    EIGY Q  D+  +    F  ++   +   KD  G DR
Sbjct: 229 ENGKLYFEIGYKQGQDLTDLLALHFPQKQ---IRVLKDQFGQDR 269


>gi|238919471|ref|YP_002932986.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Edwardsiella ictaluri 93-146]
 gi|238869040|gb|ACR68751.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Edwardsiella ictaluri 93-146]
          Length = 279

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/262 (34%), Positives = 139/262 (53%), Gaps = 10/262 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   +++L   Q   LT+ + R ++ E +  ++G R+F+++ 
Sbjct: 22  RDAEILLEHVTGRGRSFLLAFGETLLTAAQLAQLTSLLARRVQGEPVAYLIGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP       V+I+DLGTGTGA+ LAL  E P  + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQAL-LRLPATP----VQIVDLGTGTGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             V+ +  A+ +A+ NA   G+S R + LQ  WF+ + G  F +IVSNPPYI++      
Sbjct: 137 SAVEFNPDAVALAQHNAARLGLS-RVEILQGSWFTPLAGRRFTLIVSNPPYIDAADGHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+  R IA     +L   G   +E G+ Q   V  +     
Sbjct: 196 QGDVR-FEPASALVAAEQGLADLRAIARQAPDYLALGGWLLLEHGWQQGAAVRALLTEYG 254

Query: 244 LFLVNAFKDYGGNDRVLL--FC 263
              V + +DYG N+RV L  +C
Sbjct: 255 FCRVESVRDYGNNERVTLGQYC 276


>gi|34581095|ref|ZP_00142575.1| possible protoporphyrinogen oxidase [Rickettsia sibirica 246]
 gi|28262480|gb|EAA25984.1| possible protoporphyrinogen oxidase [Rickettsia sibirica 246]
          Length = 524

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 133/262 (50%), Gaps = 21/262 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAKIEAFEKLLARRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSAL---AFSLPRIEKRD-----------------VVRILDLGTGTGAVCLALLKESPF 121
           VD      +      EK+                   + IL+LGTG+G + ++LL E P 
Sbjct: 103 VDVVFQCHSHESGNPEKKQPNPCFRGNDISENCNDKFLNILELGTGSGCIAISLLCELPH 162

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
              +  DIS  A++I KSNA    V++R   + S+WF ++E   FD IVSNPPYI     
Sbjct: 163 ANVIATDISLDAIDIIKSNAAKYEVTDRIQIIHSNWFENIETQKFDFIVSNPPYIAHSEK 222

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             + +E  +++P I+L    DGL  Y  IA+   + L  +G   +EIG+ Q+  V +IF 
Sbjct: 223 SEMAIETINYEPSIALFAEKDGLQAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFL 282

Query: 241 SRKLFLVNAFKDYGGNDRVLLF 262
                + + +KD  G+ RV+LF
Sbjct: 283 DHGYNIESVYKDLQGHSRVILF 304


>gi|50121118|ref|YP_050285.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pectobacterium atrosepticum SCRI1043]
 gi|49611644|emb|CAG75093.1| protein methyltransferase [Pectobacterium atrosepticum SCRI1043]
          Length = 281

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 140/259 (54%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   ++   ++ L   ++  LT  + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRTFLLAFGETELSAAEQQPLTELLARREQGEPIAYLIGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP+        +LDLGTGTGA+ LAL  E    + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQAL-LRLPQTP----CSVLDLGTGTGAIALALASERRDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
           +GVD+   A+ +A  NA    + + RF  L   W+S +E + F +IVSNPPYI+   V  
Sbjct: 137 IGVDLQPDAVALATKNAQQLKLDNARF--LPGSWYSPLEHMRFALIVSNPPYIDVDDVHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L    +GL+  R I +    +L+  G   +E G+ Q   V R+ + R
Sbjct: 195 AQGDVR-FEPASALIAADNGLADLRAIIESAPHYLDAGGWLLLEHGWQQGDAVRRLLQVR 253

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +  ++DYGGNDRV L
Sbjct: 254 GFTQIETYQDYGGNDRVSL 272


>gi|225575053|ref|ZP_03783663.1| hypothetical protein RUMHYD_03142 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037723|gb|EEG47969.1| hypothetical protein RUMHYD_03142 [Blautia hydrogenotrophica DSM
           10507]
          Length = 283

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 127/243 (52%), Gaps = 21/243 (8%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWR-------------DFYNVRLTLSSDTFEPRPET 78
           DR  +FL  +     + E   R++  R              F  +   +      PR +T
Sbjct: 38  DRAHYFLRESEEAGSQEEEYRRLISLRCGRIPLQHLTHQAWFMGLEFYVDGRVLVPRQDT 97

Query: 79  ELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAK 138
           E+LV+ A+     R+E  D  R+LD+ TG+G + L++L + P  KG GVD+S  ALE+A+
Sbjct: 98  EILVEEAVR----RLE--DGQRLLDMCTGSGCILLSILSQKPCCKGTGVDLSADALEVAR 151

Query: 139 SNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDG 198
            N     ++  F   QSD F+ + G +++IVSNPPYI + ++  L  EVR +DP ++LDG
Sbjct: 152 LNGRRLNITADFR--QSDLFTDIGGRYEMIVSNPPYIPTGVIPTLEEEVRSYDPNLALDG 209

Query: 199 GIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           G DGLS YR I +  S  L   G    EIG++Q   V  + E+     +   KD  G DR
Sbjct: 210 GEDGLSFYRRIVEQASTRLEDGGWLLFEIGHDQGRCVRDMMENAGYGELQVVKDLAGRDR 269

Query: 259 VLL 261
           V+L
Sbjct: 270 VVL 272


>gi|310767483|gb|ADP12433.1| Protein methyltransferase [Erwinia sp. Ejp617]
          Length = 281

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 136/256 (53%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DS LD      L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRAWLIGFDDSELDAVALAQLDALLKRRTAGEPIAYLTGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L+++ DT  PRP++E+LV+ ALA  LP         ILDLGTG+GA+ LAL  E P  + 
Sbjct: 82  LSVTPDTLIPRPDSEVLVEQALAH-LPVAAG----SILDLGTGSGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +G+D    A+ +A+ NA   G++     +  DWFS++ +  F VIVSNPPYI++      
Sbjct: 137 IGIDRIPAAVALAQHNAARLGLTNA-TFMPGDWFSALKQQQFAVIVSNPPYIDATDKHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+  + IA    ++L   G   +E G+ Q   + +I     
Sbjct: 196 QGDVR-FEPASALVAGDGGLADIKIIAAQAGQYLANGGWLLLEHGWQQGAQIRQILSDHH 254

Query: 244 LFLVNAFKDYGGNDRV 259
              +   +DYGGNDRV
Sbjct: 255 FCQIATCQDYGGNDRV 270


>gi|171462957|ref|YP_001797070.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192495|gb|ACB43456.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 280

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 123/218 (56%), Gaps = 8/218 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDL 104
           LK E I  ++G R F+N+ L ++     PRPETELLV+      L  I + +   RILDL
Sbjct: 64  LKGEPIAYLIGKRGFHNIDLFVAPGVLIPRPETELLVE----IGLQEIRRLNAPTRILDL 119

Query: 105 GTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG- 163
           GTG+GA+ LA+  E+P       D S +AL+IAK+NA    ++ + + LQ  W+ ++EG 
Sbjct: 120 GTGSGAIALAIAHEAPQAMVTATDQSNQALDIAKTNAKQLMLTNQVEFLQGSWYEAIEGN 179

Query: 164 -LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
             FD+I+SNPPYI S  +     ++R F+P  +L    D LS   TI  G  +HL  +GL
Sbjct: 180 APFDIILSNPPYIASQDLHLKQGDLR-FEPLSALTDHKDSLSCLETIISGARQHLQLNGL 238

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            +VE  ++Q   VV + +      + A  D GG+ RV+
Sbjct: 239 IAVEHSFDQSDAVVALMKQAGFHNIQAHFDLGGHYRVV 276


>gi|332532478|ref|ZP_08408356.1| methylase of polypeptide chain release factors [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038121|gb|EGI74568.1| methylase of polypeptide chain release factors [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 279

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 124/237 (52%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L D Q+      I R LK E +  I G R+F+++ L +++ T  PRP+TE LV+ A
Sbjct: 46  PEHALSDEQQSQFNVFIQRRLKGEPVAHITGLREFWSLSLEVNATTLIPRPDTETLVEQA 105

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  +LP   K     +LDLGTGTGA+ LAL  E P ++   VD    A+ +A  N     
Sbjct: 106 LEIALPATAK-----VLDLGTGTGAIALALGSEMPSWQITAVDRVSDAVALATRNQQRLA 160

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++      QS+WFS + G  F++IV+NPPYIES  +     +VR F+P  +L     G+S
Sbjct: 161 IN-NVHVKQSNWFSELHGEKFNLIVTNPPYIESSDIHLNQGDVR-FEPLSALVADDCGMS 218

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             + I      +L+ +G   +E G+ Q   V   FE      +   KD G NDRV L
Sbjct: 219 DIKQIITQSRDYLSSNGYLLIEHGFEQGEAVRHFFEKMAFVNIKTVKDLGNNDRVTL 275


>gi|85860526|ref|YP_462728.1| peptide release factor-glutamine N5-methyltransferase [Syntrophus
           aciditrophicus SB]
 gi|85723617|gb|ABC78560.1| peptide release factor-glutamine N5-methyltransferase [Syntrophus
           aciditrophicus SB]
          Length = 316

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 119/220 (54%), Gaps = 3/220 (1%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R  K E +  I+G ++F+++   +      PRP+TE+LV+  +         R    I
Sbjct: 89  VARRQKGEPVAYIIGRKEFWSLDFAVDPRVLIPRPDTEVLVEEVIKVLGSGRASRP--EI 146

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+GA+ +AL  E P  +    DIS KAL ++  NA  +GV+ R   L+ +    V
Sbjct: 147 LDLGTGSGAIAVALAHECPHARITATDISRKALAVSAGNAERHGVASRITFLEGNLLDPV 206

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
            G FDVIVSNPPYI+S     L  EVR+F+PR +L  G  G+  Y  I    +  L   G
Sbjct: 207 MGKFDVIVSNPPYIDSGDYARLSAEVRNFEPREALLAGEQGMDFYSAIIPQAACRLKPGG 266

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAF-KDYGGNDRVL 260
              +EIG +QK ++ R+F+    +   AF KDY G  RV+
Sbjct: 267 WLLLEIGDSQKENLNRLFQQSDAYQDLAFRKDYAGRWRVV 306


>gi|55822720|ref|YP_141161.1| protoporphyrinogen oxidase [Streptococcus thermophilus CNRZ1066]
 gi|55738705|gb|AAV62346.1| protoporphyrinogen oxidase [Streptococcus thermophilus CNRZ1066]
          Length = 277

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 124/230 (53%), Gaps = 14/230 (6%)

Query: 37  FLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKR 96
            L +   +   H+    ILG+ +F+ +R  +      PRPETE LVD  LA + P  E  
Sbjct: 54  LLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAEN-PNTE-- 110

Query: 97  DVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSD 156
             +++LD+GTG+GA+ ++L K  P ++    D+S  AL +AK NA  N V   F  + +D
Sbjct: 111 --LKVLDIGTGSGAIAVSLKKSRPMWQVTASDLSADALVLAKDNAKLNRVDISF--VLAD 166

Query: 157 WFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            F +V G FD+IVSNPPYI     D +GL V   +P+++L    DGL+ YR I +   ++
Sbjct: 167 VFENVSGCFDIIVSNPPYISENDKDEVGLNVLTSEPKMALFADEDGLAIYRQILEDADKY 226

Query: 217 LNKDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           LN  G    EIGY Q  D+ ++    F  +    V   KD  G DR+++ 
Sbjct: 227 LNPQGKLYFEIGYKQGEDLRKLLSLHFPDKH---VRVLKDQFGQDRMVVM 273


>gi|258621066|ref|ZP_05716100.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586454|gb|EEW11169.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 286

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 134/261 (51%), Gaps = 15/261 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L++     L   + R +  E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEEPALVSLNALLARRMAGEPVAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------EKAALIEGELLDLGTGTGAIALALASELPLRR 139

Query: 124 GVGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIV 180
             G+D+  +A+E+A+ NA    + + +F  LQ  WFS +     F +IVSNPPYIE    
Sbjct: 140 VTGIDLRPEAVELAQENATRLSILNTQF--LQGSWFSPLADGTKFALIVSNPPYIEENDP 197

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P+ +L    +GL+  R I+    R L + G    E GY+Q   V  I  
Sbjct: 198 HLNQGDVR-FEPKSALVAEENGLADIRYISTHAPRFLLEGGWLLFEHGYDQGEAVRTILR 256

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                 V   +DY GNDRV L
Sbjct: 257 ELGYQSVTTEQDYAGNDRVTL 277


>gi|219682102|ref|YP_002468486.1| HemK protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|219621835|gb|ACL29991.1| HemK protein [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
 gi|311085915|gb|ADP65997.1| HemK protein [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)]
 gi|311086486|gb|ADP66567.1| HemK protein [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)]
 gi|311087069|gb|ADP67149.1| HemK protein [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)]
 gi|311087621|gb|ADP67700.1| HemK protein [Buchnera aphidicola str. JF98 (Acyrthosiphon pisum)]
          Length = 277

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/256 (33%), Positives = 138/256 (53%), Gaps = 7/256 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   L  VT  +   +I+  +  L ++Q  +L + I R    E I  I+  ++F+++ L
Sbjct: 23  ESELLLSYVTKHTRSFIIISDEIQLTEKQYKYLNHLIHRRSLGEPIAYIIKEKEFWSLSL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S DT  PRP+TE+LV+ AL+    +I K +   ILDLGTG GA+ LAL   +  +  +
Sbjct: 83  CVSYDTLIPRPDTEILVERALS----KI-KSNSACILDLGTGCGAIALALASINSNWNII 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+D S  AL IA+ NA      +      SDWFS+++  F++IVSNPPY+    +     
Sbjct: 138 GIDKSENALAIARINASKLNF-KNVTFFFSDWFSNIKKKFNIIVSNPPYVSKKEIKFFKK 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           ++  F+P  +L    +GLS    I      +L   G   +E G+ QKV V  +F+     
Sbjct: 197 DIF-FEPLSALISDNNGLSDIENIIKNSKHYLFYGGWLMIEHGWRQKVKVQYLFKKYNFH 255

Query: 246 LVNAFKDYGGNDRVLL 261
            + +++DYGGNDRV +
Sbjct: 256 EIESYQDYGGNDRVTI 271


>gi|269961570|ref|ZP_06175932.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833611|gb|EEZ87708.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 285

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 134/261 (51%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R +  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPERALETEQQAQFDALLERRIAGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTFGQTGP-----ILDLGTGTGAIALALASEMPNRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDC 182
           G+D+  +A E+A+ NA    +    FD  Q  WF  +     F +IVSNPPYI+      
Sbjct: 144 GIDLKQEAKELAEHNASQLNIKNVTFD--QGSWFEPIASGTKFALIVSNPPYIDEKDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P+ +L    +GL+  R I+D   ++L + G  + E GY+Q   V  I    
Sbjct: 202 SQGDVR-FEPKSALVADENGLADIRHISDLARQYLQEGGWLAFEHGYDQGEAVREIMTHF 260

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
               V   KDYG NDRV L C
Sbjct: 261 GFEQVVTEKDYGDNDRVTLGC 281


>gi|329766952|ref|ZP_08258480.1| protein-(glutamine-N5) methyltransferase [Gemella haemolysans M341]
 gi|328837677|gb|EGF87302.1| protein-(glutamine-N5) methyltransferase [Gemella haemolysans M341]
          Length = 280

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 122/213 (57%), Gaps = 11/213 (5%)

Query: 56  GWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLAL 115
           G+  FY+ +  ++ D   PR ETE L+   + + +  I K ++ +ILDL TG+G + + L
Sbjct: 74  GFEYFYDRKFKVTKDVLSPRMETEELIYKVIEY-IKSINKNNI-KILDLCTGSGIIGITL 131

Query: 116 LKE--SPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPP 173
            KE  S   K V  DIS +AL++AK NA+ N    +F  +QSD F ++   FD+IVSNPP
Sbjct: 132 RKELESKSLKVVASDISEEALKVAKENAIMNEAEVKF--IQSDIFENINEKFDIIVSNPP 189

Query: 174 YIESVIVDCLGLE--VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
           YI     D + +E  V ++DP ++L    DG+  YR I +    +LNKDG+   EIGY+Q
Sbjct: 190 YI--AYSDKITMEDNVLNYDPHLALFAEEDGMYFYREIVENSKEYLNKDGMIFFEIGYDQ 247

Query: 232 KVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
           +  ++++    + F    +KD  G DR+ +  R
Sbjct: 248 REKILKLANENE-FKAEVYKDINGRDRMAILER 279


>gi|292488089|ref|YP_003530966.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Erwinia amylovora CFBP1430]
 gi|292899300|ref|YP_003538669.1| protein methyltransferase [Erwinia amylovora ATCC 49946]
 gi|291199148|emb|CBJ46262.1| protein methyltransferase [Erwinia amylovora ATCC 49946]
 gi|291553513|emb|CBA20558.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Erwinia amylovora CFBP1430]
          Length = 281

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 135/256 (52%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DSVLD      L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLQLVTGKSRAWLIGFDDSVLDAAALEQLHALLTRRAAGEPIAYLTGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP++E+LV+ ALA  LP         ILDLGTG+GA+ LAL  E P  + 
Sbjct: 82  LNVTPDTLIPRPDSEVLVEQALAH-LPDA----ACSILDLGTGSGAIALALASERPDCQI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCL 183
            G+D    A+ +A+ NA   G++     +  +WFS+++   F VIVSNPPYI++      
Sbjct: 137 SGIDRIPAAVALAQHNAARLGLANA-TFMPGNWFSALKPQQFAVIVSNPPYIDAADKHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+  + IA    ++L   G   +E G+ Q   + +I     
Sbjct: 196 QGDVR-FEPASALVAGDGGLADIKIIAAQAGQYLANGGWLLLEHGWQQGAQIRQILSDNH 254

Query: 244 LFLVNAFKDYGGNDRV 259
              +   +DYGGNDRV
Sbjct: 255 YCRIETCQDYGGNDRV 270


>gi|262166265|ref|ZP_06034002.1| Polypeptide chain release factor methylase [Vibrio mimicus VM223]
 gi|262025981|gb|EEY44649.1| Polypeptide chain release factor methylase [Vibrio mimicus VM223]
          Length = 286

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 134/261 (51%), Gaps = 15/261 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L++     L + + R +  E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEEPALVSLNSLLTRRMAGEPVAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------EKAALIEGELLDLGTGTGAIALALASELPLRR 139

Query: 124 GVGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIV 180
             G+D+  +A E+A+ NA    + + +F  LQ  WFS +     F +IVSNPPYIE    
Sbjct: 140 VTGIDLRPEAAELAQENATRLSILNTQF--LQGSWFSPLADGTKFALIVSNPPYIEENDP 197

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P+ +L    +GL+  R I+    R L + G    E GY+Q   V  I  
Sbjct: 198 HLNQGDVR-FEPKSALVAEENGLADIRYISTHAPRFLLEGGWLLFEHGYDQGEAVRTILR 256

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                 V   +DY GNDRV L
Sbjct: 257 ELGYQSVTTEQDYAGNDRVTL 277


>gi|116627621|ref|YP_820240.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMD-9]
 gi|116100898|gb|ABJ66044.1| Methylase of polypeptide chain release factor [Streptococcus
           thermophilus LMD-9]
 gi|312278143|gb|ADQ62800.1| Protein-(Glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus thermophilus ND03]
          Length = 277

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 124/230 (53%), Gaps = 14/230 (6%)

Query: 37  FLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKR 96
            L +   +   H+    ILG+ +F+ +R  +      PRPETE LVD  LA + P  E  
Sbjct: 54  LLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAEN-PNTE-- 110

Query: 97  DVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSD 156
             +++LD+GTG+GA+ ++L K  P ++    D+S  AL +AK NA  N V   F  + +D
Sbjct: 111 --LKVLDIGTGSGAIAVSLKKSRPMWQVTASDLSADALVLAKDNAKLNRVDISF--VLAD 166

Query: 157 WFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            F +V G FD+IVSNPPYI     D +GL V   +P+++L    DGL+ YR I +   ++
Sbjct: 167 VFENVSGCFDIIVSNPPYISENDKDEVGLNVLTSEPKMALFADEDGLAIYRQILEDADKY 226

Query: 217 LNKDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           LN  G    EIGY Q  D+ ++    F  +    V   KD  G DR+++ 
Sbjct: 227 LNPQGKLYFEIGYKQGEDLRKLLSLHFPDKH---VRVLKDQFGQDRMVVM 273


>gi|296327944|ref|ZP_06870479.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296154900|gb|EFG95682.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 383

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 144 VLRAKKRKPLQYILGEWEFYGLPFKMSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 199

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+++A  N + N + E  + ++S+ F  +
Sbjct: 200 LDIGSGSGAISIAVANELKSSSVTGIDINEKAIKLAIENKILNKI-ENVNFIESNLFGKL 258

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  Y+ I+     +L  
Sbjct: 259 DKDFKYDLIVSNPPYISKEEYETLMPEVKNYEPQNALTDLGDGLHFYKEISKLAGEYLKD 318

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I +     +++  KDYGGNDRV++
Sbjct: 319 TGYLAFEIGYNQAKDVSKILQDNNFAILSIVKDYGGNDRVII 360


>gi|254504444|ref|ZP_05116595.1| methyltransferase, HemK family [Labrenzia alexandrii DFL-11]
 gi|222440515|gb|EEE47194.1| methyltransferase, HemK family [Labrenzia alexandrii DFL-11]
          Length = 280

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 43  VRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRIL 102
            + L  + + RILG R+FY     L+  T EPRP+TE L+++ L    P       + + 
Sbjct: 62  AQRLNGKPVGRILGEREFYGRTFRLNHATLEPRPDTETLIETVLKDCDPT----RPLTMC 117

Query: 103 DLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE 162
           D+GTGTGA+ + LL E      V VDIS  AL  A SNA  +GV  RF  ++SD+ ++++
Sbjct: 118 DIGTGTGAIAVTLLAELQKAVMVAVDISEDALGCAVSNAENHGVGARFLPVRSDYAAALQ 177

Query: 163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
             FD ++SNPPYI + ++  L  EV   DP ++LDGG DGL  YR I    +  L   G 
Sbjct: 178 HGFDWVISNPPYIRTPVLRELSKEVLQHDPILALDGGADGLEGYRQIVSQAASVLVPGGR 237

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            ++EIG +Q  ++           ++  +D G  DRV
Sbjct: 238 IALEIGRDQGEELKNQLRHHGFEAIDIIQDLGRRDRV 274


>gi|197335225|ref|YP_002155530.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio fischeri MJ11]
 gi|197316715|gb|ACH66162.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio fischeri MJ11]
          Length = 284

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (49%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  P+ ++ D +       + R L  E I  I+G+R+F+++ L
Sbjct: 27  DAAVLLCHVLDKPRSYLLTWPEKIVSDEELGNFNALLERRLAGEPIAYIVGYREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL    P  +      ILDLGTGTGA+ LA+  E P    +
Sbjct: 87  KVSPTTLIPRPDTERLVEVALDHLTPNAQS-----ILDLGTGTGAIALAIASEMPTLNVI 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS--SVEGLFDVIVSNPPYIESVIVDCL 183
           GVD    A+E+AK NA  N ++   +  Q  WF   S+   FD+IVSNPPYI+       
Sbjct: 142 GVDYQDDAVELAKENAKINHIN-NVEFRQGSWFEPISLSDKFDIIVSNPPYIDGNDPHLS 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +G S    I      +L   G   +E G+ Q   +   FE   
Sbjct: 201 EGDVR-FEPQTALVAEQNGFSDLIHIMQHGREYLLNGGWLMMEHGFEQGEQLRHFFEEHG 259

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DY GNDRV L
Sbjct: 260 YINVKTEQDYTGNDRVTL 277


>gi|55820817|ref|YP_139259.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMG 18311]
 gi|55736802|gb|AAV60444.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMG 18311]
          Length = 277

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 124/230 (53%), Gaps = 14/230 (6%)

Query: 37  FLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKR 96
            L +   +   H+    ILG+ +F+ +R  +      PRPETE LVD  LA + P  E  
Sbjct: 54  LLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAEN-PNTE-- 110

Query: 97  DVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSD 156
             +++LD+GTG+GA+ ++L K  P ++    D+S  AL +AK NA  N V   F  + +D
Sbjct: 111 --LKVLDIGTGSGAIAVSLKKSRPMWQVTASDLSADALVLAKDNAKLNRVDISF--VLAD 166

Query: 157 WFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            F +V G FD+IVSNPPYI     D +GL V   +P+++L    DGL+ YR I +   ++
Sbjct: 167 VFENVSGCFDIIVSNPPYISENDKDEVGLNVLTSEPKMALFADEDGLAIYRQILEDADKY 226

Query: 217 LNKDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLLF 262
           LN  G    EIGY Q  D+ ++    F  +    V   KD  G DR+++ 
Sbjct: 227 LNPQGKLYFEIGYKQGEDLRKLLSLHFPDKH---VRVLKDQFGQDRMVVM 273


>gi|253990003|ref|YP_003041359.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781453|emb|CAQ84616.1| protein methyltranferase hemk (protein-glutamine n
           methyltransferase) [Photorhabdus asymbiotica]
          Length = 283

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 137/260 (52%), Gaps = 12/260 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT  S   ++   ++ +   Q   L   + R  K E I  I G R+F+++ 
Sbjct: 23  RDAEILLGFVTRHSRTYILAFGETQISPEQFSQLETLLARRAKGEPIAYITGEREFWSLS 82

Query: 65  LTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           LT+S  T  PRP+TE LV+ AL   SL         RILDLGTGTGA+ LA+  E    +
Sbjct: 83  LTVSPATLIPRPDTECLVEKALECLSL------TPCRILDLGTGTGAIALAIASERSDCQ 136

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
             GVDI+  A+ +A+ NA    + +  D L S+WFSS+    FD+IVSNPPYI+      
Sbjct: 137 VTGVDINPDAVMLAQGNAEKLKI-QNVDFLNSNWFSSLNNQQFDMIVSNPPYIDEADPHL 195

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR-IFES 241
              +VR F+P  +L     G +  +TI D     L  DG   +E G+ Q  DVVR +F  
Sbjct: 196 FQGDVR-FEPDSALIAAEQGTADLKTIIDLSRNFLLPDGWLLLEHGWKQG-DVVRSLFSE 253

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V  F+DYGGN+R+ L
Sbjct: 254 SGYQQVATFQDYGGNERITL 273


>gi|227111331|ref|ZP_03824987.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 281

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 139/258 (53%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   ++   ++ L+  ++  LT  ++R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRTFLLAFGETELNTAEQQQLTELLLRREQGEPIAYLIGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP+        +LDLGTGTGA+ LAL  E    + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQAL-LRLPQTP----CAVLDLGTGTGAIALALASERHDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
            GVD+   A+ +A  NA   G+      L   W+S ++   F +I SNPPYI++  V   
Sbjct: 137 TGVDVQPDAVALATKNAQQLGLG-NVHFLSGSWYSPLDHTRFALIASNPPYIDADDVHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  RTI +    +L+ DG   +E G+ Q   V ++  +R 
Sbjct: 196 QGDVR-FEPASALIAADNGLADLRTIIESAPHYLDDDGWLLLEHGWQQADAVRQLLHARG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              +   +DYGGNDRV L
Sbjct: 255 FTQIETCQDYGGNDRVSL 272


>gi|323704814|ref|ZP_08116391.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535740|gb|EGB25514.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 279

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 142/260 (54%), Gaps = 14/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESI--HRILGWRDFYNV 63
           ++   L  + G+    +IV+ D  L   +  F     +  L+ + +    I+G + F  +
Sbjct: 24  EAEGLLSFLLGVGREYIIVNRDKEL--SENIFERYKGLLDLRKDGMPYQYIVGKKHFMGL 81

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +S +   PR +TE+LV+  L     R++K DVV  LD+GTG+GA+ +++ K     K
Sbjct: 82  IFKVSPNVLIPRNDTEVLVEEVLK----RLQKNDVV--LDIGTGSGAIAVSIAKYKDV-K 134

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVD 181
              VDIS  AL +A+ NA  NGV ++   L+SD FSSV  +  FDVIVSNPPYI S  +D
Sbjct: 135 VYAVDISDDALSVARDNAYENGVLDKIVFLKSDLFSSVPKDVKFDVIVSNPPYIRSGDID 194

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EV+  +P+I+LDGG DGL  YR I      ++   G+ + E+GY++  DV RI   
Sbjct: 195 KLQEEVKK-EPKIALDGGEDGLLFYRKIVRDSKEYIKSSGIIAFEVGYDEAGDVSRILLD 253

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   KD  G DRV+L
Sbjct: 254 GGYGNIEIVKDLQGIDRVVL 273


>gi|313905738|ref|ZP_07839098.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Eubacterium cellulosolvens 6]
 gi|313469445|gb|EFR64787.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Eubacterium cellulosolvens 6]
          Length = 282

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 117/217 (53%), Gaps = 8/217 (3%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L H  +  I G   F      ++ D   PR +TE+LV+ AL    P +      RILD
Sbjct: 68  RRLGHLPVQHITGEAWFCGYSFYVTEDVLIPRQDTEVLVEEALRVLRPGM------RILD 121

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE 162
           + TG+G + L+LLK      G  VD+S  AL +A+ N    G++E +   L SD F  VE
Sbjct: 122 MCTGSGCILLSLLKGREV-TGTAVDLSPAALAVAEENRKRLGIAEDQVKFLHSDLFEKVE 180

Query: 163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
           G +D+IV+NPPYI + +   L  EVRD +P ++LDG  DGL   R IA+    +L KD +
Sbjct: 181 GCYDMIVTNPPYIPTEVCQELDPEVRDHEPMMALDGREDGLYFERKIAEDAKAYLKKDAM 240

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
             +EIGY+Q   +  I  S     V   +D GGNDRV
Sbjct: 241 IFMEIGYDQGDAMREILLSLGYKDVRIVRDLGGNDRV 277


>gi|312172220|emb|CBX80477.1| K02493 methyltransferase [Erwinia amylovora ATCC BAA-2158]
          Length = 295

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 135/256 (52%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DSVLD      L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLQLVTGKSRAWLIGFDDSVLDAAALEQLHALLTRRAAGEPIAYLTGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP++E+LV+ ALA  LP         ILDLGTG+GA+ LAL  E P  + 
Sbjct: 82  LNVTPDTLIPRPDSEVLVEQALAH-LPDA----ACSILDLGTGSGAIALALASERPDCQI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
            G+D    A+ +A+ NA   G++     +  +WFS+++   F VIVSNPPYI++      
Sbjct: 137 SGIDRIPAAVALAQHNAARLGLANA-TFMPGNWFSALKPQQFAVIVSNPPYIDAADKHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+  + IA    ++L   G   +E G+ Q   + +I     
Sbjct: 196 QGDVR-FEPASALVAGDGGLADIKIIAAQAGQYLANGGWLLLEHGWQQGAQIRQILSDNH 254

Query: 244 LFLVNAFKDYGGNDRV 259
              +   +DYGGNDRV
Sbjct: 255 YCRIETCQDYGGNDRV 270


>gi|254230551|ref|ZP_04923919.1| protein methyltransferase HemK (Protein-glutamine
           N-methyltransferase hemK) (Protein-(glutamine-N5) MTase
           hemK) [Vibrio sp. Ex25]
 gi|262394971|ref|YP_003286825.1| Polypeptide chain release factor methylase [Vibrio sp. Ex25]
 gi|151936923|gb|EDN55813.1| protein methyltransferase HemK (Protein-glutamine
           N-methyltransferase hemK) (Protein-(glutamine-N5) MTase
           hemK) [Vibrio sp. Ex25]
 gi|262338565|gb|ACY52360.1| Polypeptide chain release factor methylase [Vibrio sp. Ex25]
          Length = 284

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 132/260 (50%), Gaps = 9/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R L  E +  I+G R+F+++  
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEAEQQAKFNALLERRLAGEPVAYIIGEREFWSLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ +AL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTY-----EQTGPILDLGTGTGAIAIALASEMPTRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDCL 183
           GVD+  +A  +A+ NA    + +     Q  WF  + EG  F +IVSNPPYI+       
Sbjct: 144 GVDLKQEAKALAEYNAEQLNI-KNVTFAQGSWFEPITEGTKFALIVSNPPYIDEKDPHLS 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +GL+  R I+D   ++L   G  + E GY+Q   V  I     
Sbjct: 203 QGDVR-FEPKSALVAKENGLADIRHISDLARQYLEVGGWLAFEHGYDQGDAVREIMRGFG 261

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              V   KDYGGNDRV L C
Sbjct: 262 YQQVATEKDYGGNDRVTLGC 281


>gi|319779046|ref|YP_004129959.1| Methylase of polypeptide chain release factor [Taylorella
           equigenitalis MCE9]
 gi|317109070|gb|ADU91816.1| Methylase of polypeptide chain release factor [Taylorella
           equigenitalis MCE9]
          Length = 275

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 137/261 (52%), Gaps = 17/261 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   L  V G+    + V  D ++ + Q+      + R L+ E I  ++G R+F  + L
Sbjct: 19  ESQIILAHVLGVDRVWLFVHDDVLICEEQKLEFDTLVQRRLEGEPIAYLVGSREFMGLEL 78

Query: 66  TLSSDTFEPRPETELLVDSALAF--SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            + +    PRP+TELLV+ AL F  + P        RILDLGTG+GA+ +++    P  +
Sbjct: 79  NVDNSVLIPRPDTELLVECALDFLKTTPT-----GARILDLGTGSGAIAISIANFMPKCE 133

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE---GLFDVIVSNPPYIESVIV 180
              VDIS +AL++A  NA  +GV  +F   +  WF ++    G FD+IVSNPPYI S   
Sbjct: 134 VYAVDISKEALKVAYLNAKNHGVHIKF--FEGSWFDALPYDVGTFDLIVSNPPYIAS--- 188

Query: 181 DCLGLEVRD--FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
           D + L++ D  ++P  +L GG DGLS Y  I   V   ++       E G+ Q  ++ RI
Sbjct: 189 DDIHLQLGDVRYEPITALVGGNDGLSEYIKIMKQVHDFIHSGSAIMFEHGWTQGAELRRI 248

Query: 239 FESRKLFLVNAFKDYGGNDRV 259
            E      +N  KD  G++RV
Sbjct: 249 LEQGHCHKINTHKDLAGHERV 269


>gi|114768931|ref|ZP_01446557.1| HemK [alpha proteobacterium HTCC2255]
 gi|114549848|gb|EAU52729.1| HemK [alpha proteobacterium HTCC2255]
          Length = 277

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 122/230 (53%), Gaps = 8/230 (3%)

Query: 31  DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSL 90
           DD   +F T  I + L+ + I +I+G R F+  +  +S +  +PRP+TE L++  L+   
Sbjct: 50  DDIYNYFKT-LINKRLEFQPISQIIGERYFWKNKFIVSPNVLDPRPDTETLIEHTLS--- 105

Query: 91  PRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERF 150
               +     ILDLGTG+G + L+LL E     GVG+D S  AL +AK NA    +S+R 
Sbjct: 106 ----QGKFYNILDLGTGSGCIILSLLDEYKDAIGVGIDKSEDALNVAKQNANLLSLSQRV 161

Query: 151 DTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIA 210
                +W   ++  FD+I+SNPPYI    +  L   V +++PRI+L    DGL  YR I 
Sbjct: 162 SFNLGNWCEGIKEKFDLIISNPPYISENDMKILSKSVLNWEPRIALTPEGDGLGAYRHIL 221

Query: 211 DGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           DG    L  +G   +EIGY+Q   V  + ++     +   KD    DRVL
Sbjct: 222 DGAKNLLIPNGKLILEIGYDQGKKVTHLLKNHGYKDIKLVKDINNKDRVL 271


>gi|89094906|ref|ZP_01167838.1| Methylase of polypeptide chain release factor [Oceanospirillum sp.
           MED92]
 gi|89080863|gb|EAR60103.1| Methylase of polypeptide chain release factor [Oceanospirillum sp.
           MED92]
          Length = 283

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 129/259 (49%), Gaps = 17/259 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D    LC V       +   P+  L   ++  L   + R LK E +  I+G R F++  L
Sbjct: 23  DMQYLLCHVLDKPESYLFTWPERELQPGEQESLEQLLQRRLKGEPVAHIIGKRGFWSFEL 82

Query: 66  TLSSDTFEPRPETELLVDSALAF-SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            +S  T  PRP+TE+LV+ AL   SLP        R++DLGTGTGAV LAL KE+P ++ 
Sbjct: 83  EVSPHTLIPRPDTEVLVEKALELCSLP------AARVVDLGTGTGAVALALAKENPGWEV 136

Query: 125 VGVDISCKALEIAKSN----AVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
              D   +A E+A+ N     +TN        LQ  W+    G FD+IVSNPPYI+    
Sbjct: 137 FASDYVKEAAELAERNRQRLHITN-----MQVLQGSWYEPHSGRFDMIVSNPPYIDPEDP 191

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P  +L     G++    IA      LNK+G+ + E G++Q      + +
Sbjct: 192 HLDQGDVR-FEPLSALTAENQGMADIELIAKQGRNFLNKNGVLAFEHGFDQGPICRNLLQ 250

Query: 241 SRKLFLVNAFKDYGGNDRV 259
           +     V   +DYG N+RV
Sbjct: 251 TLGYLEVGTQRDYGQNERV 269


>gi|331002271|ref|ZP_08325790.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae oral
           taxon 107 str. F0167]
 gi|330411365|gb|EGG90781.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae oral
           taxon 107 str. F0167]
          Length = 275

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 129/224 (57%), Gaps = 13/224 (5%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L   + + L +  +  I+    F  + L +  +   PR +TE+LV+  L       +K  
Sbjct: 58  LKEYVEKRLTNMPVQYIVNKAYFCGLPLYVDENVLIPRFDTEVLVEEVLNLG----DKNK 113

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
             +ILD+ TG+GA+ +AL K   F +   +DIS +AL+IAK NA    +    + L+SD 
Sbjct: 114 --KILDVCTGSGAIAIALKKLGKFERVDALDISEEALKIAKKNA--KALECDINFLKSDM 169

Query: 158 FSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR 215
           FSS+  E  +D+IVSNPPYI+S IVD L  +V+DF+PR++LDG IDG+  Y+ I      
Sbjct: 170 FSSLTSENKYDIIVSNPPYIQSHIVDSLERQVKDFEPRLALDGDIDGMKFYKIIEKNFMN 229

Query: 216 HLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            L+  G+  +EIGY++  D+  +FE +K+ +    KD  G DRV
Sbjct: 230 FLSPGGILGLEIGYDEASDIKNLFEDKKVIIK---KDLAGLDRV 270


>gi|296101960|ref|YP_003612106.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295056419|gb|ADF61157.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 276

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 133/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q   L+  + R    E +  ++G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKARTYLLAFGETELTVEQEAQLSALLARRKTGEPVAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S+ T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P    
Sbjct: 82  LFVSAATLIPRPDTECLVEQALA-RLPAAAS----RILDLGTGTGAIALALATERPDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A+ N    GV+     LQS WFS++E   F +IVSNPPYI+       
Sbjct: 137 TAVDVMPDAVALAQRNVERLGVT-NVTVLQSSWFSALEKQTFAMIVSNPPYIDEHDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I     +HL   G   VE G+ Q   V  +F    
Sbjct: 196 QGDVR-FEPLTALVAGNAGLADLEHIVTTSRQHLLPGGWLLVEHGWTQGEAVRGLFRQTG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YAAVETCRDYGGNERLTL 272


>gi|330811718|ref|YP_004356180.1| methyltransferase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379826|gb|AEA71176.1| Putative methyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 276

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 129/244 (52%), Gaps = 18/244 (7%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++        +  + R    E +  ILG + F+ + L ++  T  PRP+TELLV++A
Sbjct: 42  PERIVPSEAALLFSEYLRRRRSGEPVAYILGQQGFWKLDLEVAPHTLIPRPDTELLVETA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           LA  LP        R+LDLGTG+GA+ LAL  E P +K   VD   +A+ +A+ N     
Sbjct: 102 LAL-LPATP----ARVLDLGTGSGAIALALASERPAWKVTAVDRVLEAVALAERN----- 151

Query: 146 VSERFD-----TLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGG 199
             +R D      L S WFS++E   F++I+SNPPYI +     +  +VR F+P  +L  G
Sbjct: 152 -RQRLDLHNVTVLSSHWFSALEDTRFELIISNPPYIAASDPHLIEGDVR-FEPASALVAG 209

Query: 200 IDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            DGL   R I      HL+  G   +E GY+Q   V  +  ++    V++ KD GG++R+
Sbjct: 210 PDGLDDLRQIVAQAPAHLDPGGWLMLEHGYDQAEAVRDLLRTQGFVEVHSRKDLGGHERI 269

Query: 260 LLFC 263
            L C
Sbjct: 270 SLGC 273


>gi|260220344|emb|CBA27787.1| Protein hemK homolog [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 292

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 116/230 (50%), Gaps = 9/230 (3%)

Query: 29  VLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF 88
           +L ++    LT    R L  E +  ++G ++FY + L +S+D   PRP+TE LV+    +
Sbjct: 61  LLSEQALITLTRLANRRLAGEPVAYLVGHKEFYGLNLQVSADVLVPRPDTETLVE----W 116

Query: 89  SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE 148
           +L  +E     R++DLGTG+GA+ LAL    P  +   VD S  AL +A+ NA   G+  
Sbjct: 117 ALETLEPTPHARVVDLGTGSGAIALALKATRPELQVEAVDFSHAALAVAQGNAQRLGLEV 176

Query: 149 RFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRT 208
            F   Q  W  S EG F +IVSNPPYI     D   L    F+PR +L  G DGL   RT
Sbjct: 177 AFG--QGSWLGSAEGKFQLIVSNPPYIRE---DDEHLPALRFEPRQALTAGTDGLDDIRT 231

Query: 209 IADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           I      HL   G    E GY+Q  DV  +  +     V + +D  G +R
Sbjct: 232 IIRQAPEHLLAGGWLLFEHGYDQAGDVRGLLAAAGFSEVQSRRDLAGIER 281


>gi|262404523|ref|ZP_06081078.1| Polypeptide chain release factor methylase [Vibrio sp. RC586]
 gi|262349555|gb|EEY98693.1| Polypeptide chain release factor methylase [Vibrio sp. RC586]
          Length = 286

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 133/261 (50%), Gaps = 15/261 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L++     L   + R +  E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEESALVSLNALLARRITGEPVAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------EKAALIEGELLDLGTGTGAIALALASELPLRR 139

Query: 124 GVGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIV 180
             G+D+  +A E+A+ NA    + + +F  LQ  WFS + G   F +IVSNPPYIE    
Sbjct: 140 VTGIDLRPEAAELAQENATRLSILNTQF--LQGSWFSPLAGGTKFALIVSNPPYIEENDP 197

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P+ +L    +GL+  R I+      L + G    E GY+Q   V  I  
Sbjct: 198 HLNQGDVR-FEPKSALVAEENGLADIRYISTHAPHFLLEGGWLLFEHGYDQGEAVRTILR 256

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                 V   +DY GNDRV L
Sbjct: 257 DLGYQSVTTEQDYAGNDRVTL 277


>gi|269965454|ref|ZP_06179573.1| HemK protein [Vibrio alginolyticus 40B]
 gi|269829933|gb|EEZ84163.1| HemK protein [Vibrio alginolyticus 40B]
          Length = 284

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 132/260 (50%), Gaps = 9/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R L  E +  I+G R+F+++  
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEAEQQAKFDALLERRLTGEPVAYIIGEREFWSLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ +AL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTY-----EQTGPILDLGTGTGAIAIALASEMPKRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDCL 183
           GVD+  +A  +A+ NA    + +     Q  WF  + EG  F +IVSNPPYI+       
Sbjct: 144 GVDLKQEAKALAEYNAEQLNI-KNVTFAQGSWFEPITEGTKFALIVSNPPYIDEKDPHLS 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +GL+  R I+D   ++L   G  + E GY+Q   V  I     
Sbjct: 203 QGDVR-FEPKSALVAKENGLADIRHISDLARQYLEVGGWLAFEHGYDQGEAVREIMRGFG 261

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              V   KDYGGNDRV L C
Sbjct: 262 YQQVATEKDYGGNDRVTLGC 281


>gi|268317361|ref|YP_003291080.1| modification methylase, HemK family [Rhodothermus marinus DSM 4252]
 gi|262334895|gb|ACY48692.1| modification methylase, HemK family [Rhodothermus marinus DSM 4252]
          Length = 304

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/261 (32%), Positives = 128/261 (49%), Gaps = 7/261 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A R++   LC V G S  Q+   P+  +D  +R      + R L+ E +  +LG+ +F  
Sbjct: 37  ARRNAEWMLCEVLGCSRAQLYAYPERPVDAARRARFAELLARRLRREPLQYVLGYVEFLG 96

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL +      PRPETE L +  L      ++     R+LD+GTG+G + LA+       
Sbjct: 97  LRLEVGPGVLVPRPETEWLTERVLQ----ELQSTPGPRVLDVGTGSGCIALAIKHHRSDA 152

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERF---DTLQSDWFSSVEGLFDVIVSNPPYIESVI 179
                DIS +AL IA+ NA   G+   +   D L   +  +V G FD+IVSNPPY+    
Sbjct: 153 DVWACDISPEALSIARRNAERLGLQVHWVEADVLADSFPENVPGPFDLIVSNPPYLALHE 212

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
            D L  EVRD++P ++L  G D L  YR +A      L   G  + E+  +   DVV +F
Sbjct: 213 ADELPPEVRDYEPPVALYAGEDPLRFYRALARHGHVLLKPGGRLACEVHAHYGTDVVALF 272

Query: 240 ESRKLFLVNAFKDYGGNDRVL 260
           E+     V    D  GN R++
Sbjct: 273 EACGYEAVRLECDLAGNPRLV 293


>gi|19704666|ref|NP_604228.1| methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
 gi|19714974|gb|AAL95527.1| Methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
          Length = 354

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 129/222 (58%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   +S     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 115 VLRAKKRKPLQYILGEWEFYGLPFKMSEGVLIPRADTEILVEQCIQL-MREVEEPN---I 170

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+++A  N + N + E  + ++S+ F  +
Sbjct: 171 LDIGSGSGAISIAVANELKSSSVTGIDINEKAIKLAIENKILNKI-ENVNFIESNLFGKL 229

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI     + L  EV++++P+ +L    DGL  Y+ I+     +L  
Sbjct: 230 DKDFKYDLIVSNPPYISKDEYETLMPEVKNYEPQNALTDLGDGLHFYKEISKLAGEYLKD 289

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I +     +++  KDYGGNDRV++
Sbjct: 290 TGYLAFEIGYNQAKDVSKILQDNNFAILSIVKDYGGNDRVII 331


>gi|257466435|ref|ZP_05630746.1| methyltransferase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917591|ref|ZP_07913831.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691466|gb|EFS28301.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 368

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 119/221 (53%), Gaps = 6/221 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R    + +  ILG  +FY            PR +TE+LV+ A   SL    +++  +I
Sbjct: 146 IQRGKFRKPLQYILGKWEFYGYEFITDERALIPRADTEILVEQAKILSL----EKENPKI 201

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+GTGTGA+ + L KE P  + +G+DIS +AL +AK N     V      LQS+ F  +
Sbjct: 202 LDIGTGTGAIAITLAKEVPEAEVLGIDISERALSLAKENKEYQFVR-NVSFLQSNLFEKL 260

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           EG  FD+IVSNPPYI     + L  EV++++P+ +L    DG S Y+ I    + +LN+ 
Sbjct: 261 EGKSFDIIVSNPPYIPQEEYEDLMPEVKNYEPKNALTDAGDGYSFYQRIIQEANGYLNEK 320

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G    E+GY Q   V +  E  K   +   +DY G+ RV+L
Sbjct: 321 GYLLFEVGYQQAEQVKQWMEEEKFEDLYIAEDYAGHQRVVL 361


>gi|325568364|ref|ZP_08144731.1| protein-(glutamine-N5) methyltransferase [Enterococcus
           casseliflavus ATCC 12755]
 gi|325158133|gb|EGC70286.1| protein-(glutamine-N5) methyltransferase [Enterococcus
           casseliflavus ATCC 12755]
          Length = 285

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 8/217 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L+HE    +LG+ +FY  RL ++  T  PRPETE LV++ LA    ++     +R++D+G
Sbjct: 65  LQHEPPQYLLGYEEFYGHRLKVTPATLIPRPETEELVENCLA----KLPADQPLRVVDIG 120

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL 164
           TGTGA+ +AL    P +    VD+S +AL +AK NA   G   RF   Q D    V +  
Sbjct: 121 TGTGAIAIALKLARPQWSVSAVDLSAEALAVAKENATALGAEIRF--FQGDTLEPVADQQ 178

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           +D+IVSNPPYI +     + + VR+ +P+++L     GL+ Y+ +A    + L   G  +
Sbjct: 179 WDLIVSNPPYISAEEWPLMDISVREKEPKMALFAQEQGLAIYKQLAQQAPKCLAPSGQMA 238

Query: 225 VEIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
           +EIG+ Q   V ++F +      V   KD  G DR++
Sbjct: 239 LEIGFQQGQAVQQLFAAAFPNKEVTVVKDLAGQDRMV 275


>gi|269138758|ref|YP_003295459.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Edwardsiella tarda EIB202]
 gi|267984419|gb|ACY84248.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Edwardsiella tarda EIB202]
 gi|304558751|gb|ADM41415.1| hypothetical protein ETAF_1303 [Edwardsiella tarda FL6-60]
          Length = 279

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 134/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L   Q   LT+ + R  + E +  ++G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRSFLLAFGETRLTAAQLTQLTSLLARREQGEPVAYLIGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP        +I+DLGTGTGA+ LAL  E P  + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQAL-MRLPAAP----AQIVDLGTGTGAIALALASERPDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             V+ +  A+ +A+ NA   G+S R + LQ  WF+ + G  F +IVSNPPYI++      
Sbjct: 137 SAVEFNPDAVALAQHNAARLGLS-RVEILQGSWFTPLAGRRFTLIVSNPPYIDAADGHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+  R IA     HL   G   +E G+ Q   V  +     
Sbjct: 196 QGDVR-FEPASALVAAEQGLADLRAIARQAPDHLEPGGWLLLEHGWQQGAAVRALLTEYG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V + +DYG N+RV L
Sbjct: 255 FCCVESVRDYGDNERVTL 272


>gi|291612729|ref|YP_003522886.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sideroxydans lithotrophicus ES-1]
 gi|291582841|gb|ADE10499.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sideroxydans lithotrophicus ES-1]
          Length = 286

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 130/241 (53%), Gaps = 11/241 (4%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++  P+ VLD  Q+    N + R L+ E +  ILG R+F+ +   ++  T  PRPETELL
Sbjct: 45  LLAHPEQVLDATQQASYANLLQRRLQGEPVAHILGEREFFGLNFKVTPATLIPRPETELL 104

Query: 82  VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNA 141
           V+     +L RI      R+LD+GTG+GA+ L++    P  + V VD S  ALE+A+ NA
Sbjct: 105 VE----LALQRIPAHGHFRVLDMGTGSGAIALSIAHARPEAEVVAVDASGAALEVARENA 160

Query: 142 VTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGI 200
           V  G+      ++SDW++++ +  + +IVSNPPYIE+        ++R F+P  +L  G 
Sbjct: 161 VRLGI-RNATFIRSDWYAALDDKRYGLIVSNPPYIETGDAHLTQGDLR-FEPPSALASGA 218

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAF--KDYGGNDR 258
           DG+   R I     R L       +E GY Q  + VR+   +  F  N F  KD  G +R
Sbjct: 219 DGMDDIRRIVGQAHRFLELGSWLLLEHGYEQ-AETVRLLLGQNGF-ANVFSVKDIAGIER 276

Query: 259 V 259
           V
Sbjct: 277 V 277


>gi|262170843|ref|ZP_06038521.1| Polypeptide chain release factor methylase [Vibrio mimicus MB-451]
 gi|261891919|gb|EEY37905.1| Polypeptide chain release factor methylase [Vibrio mimicus MB-451]
          Length = 286

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 133/261 (50%), Gaps = 15/261 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L++     L   + R +  E I  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEEPALVSLNALLARRMAGEPIAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------EKAALIEGELLDLGTGTGAIALALASELPLRR 139

Query: 124 GVGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIV 180
             G+D+  +A E+A+ NA    + + +F  LQ  WFS +     F +IVSNPPYIE    
Sbjct: 140 VTGIDLRPEAAELAQENATRLSILNTQF--LQGSWFSPLADGTKFALIVSNPPYIEENDP 197

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P+ +L    +GL+  R I+    R L + G    E GY+Q   V  I  
Sbjct: 198 HLNLGDVR-FEPKSALVAEENGLADIRYISTHAPRFLLEGGWLLFEHGYDQGEAVRTILR 256

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                 V   +DY GNDRV L
Sbjct: 257 ELGYQSVTTEQDYAGNDRVTL 277


>gi|295697769|ref|YP_003591007.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Bacillus tusciae DSM 2912]
 gi|295413371|gb|ADG07863.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Bacillus tusciae DSM 2912]
          Length = 296

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 123/235 (52%), Gaps = 7/235 (2%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            + RV G+    +   PD VL   +   +   + R  + E +  I G  +FY + L +  
Sbjct: 29  LIQRVLGVGKAHLYAHPDRVLTQEEERRIAEGVSRRARREPLQYITGVVEFYGLELEVGP 88

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRPETE LV+  L +    + +R +  I D+GTG+GA+ +AL    P  + VG+D+
Sbjct: 89  DVLIPRPETEGLVERVLGWR--SMWERPL--IADVGTGSGALAVALAHHWPGARIVGIDV 144

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNPPYIESVIVDCLGLE 186
           S  A ++A  N   +G+++R   +Q D    +       D++VSNPPYI S  +D L  E
Sbjct: 145 SPGAFQVASRNIRRHGLADRVSLVQGDLLFPLLDHGQRADIVVSNPPYIPSGDIDGLQPE 204

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
           V  F+PR +LDGG DGL  YR +   +   L++ G  +VE+G  Q   V R+ E 
Sbjct: 205 VARFEPRAALDGGGDGLDVYRRLFFQLPEVLSRPGAVAVEVGAGQAGAVRRLLEQ 259


>gi|15893237|ref|NP_360951.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia conorii str. Malish 7]
 gi|229587214|ref|YP_002845715.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia africae ESF-5]
 gi|32129602|sp|Q92G13|HEMK_RICCN RecName: Full=Bifunctional methyltransferase; Includes: RecName:
           Full=HemK protein homolog; AltName: Full=M.RcoHemKP;
           Includes: RecName: Full=tRNA
           (guanine-N(7)-)-methyltransferase; AltName:
           Full=tRNA(m7G46)-methyltransferase
 gi|15620455|gb|AAL03852.1| possible protoporphyrinogen oxidase [Rickettsia conorii str. Malish
           7]
 gi|228022264|gb|ACP53972.1| Methylase of polypeptide chain release factors [Rickettsia africae
           ESF-5]
          Length = 524

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 132/262 (50%), Gaps = 21/262 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAKIEAFEKLLARRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSALAFSL------------PRIEKRDV--------VRILDLGTGTGAVCLALLKESPF 121
           VD                   P     D+        + IL+LGTG+G + ++LL E P 
Sbjct: 103 VDVVFQCHSRESGNPEKKQPNPCFRGNDISENCNDKFLNILELGTGSGCIAISLLCELPN 162

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
              +  DIS  A++I KSNA    V++R   + S+WF ++E   FD IVSNPPYI     
Sbjct: 163 ANVIATDISLDAIDIIKSNAAKYEVTDRIQIIHSNWFENIETQKFDFIVSNPPYIAHSEK 222

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             + +E  +++P I+L    DGL  Y  IA+   + L  +G   +EIG+ Q+  V +IF 
Sbjct: 223 SEMAIETINYEPSIALFAEKDGLQAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFL 282

Query: 241 SRKLFLVNAFKDYGGNDRVLLF 262
                + + +KD  G+ RV+LF
Sbjct: 283 DHGYNIESVYKDLQGHSRVILF 304


>gi|149907579|ref|ZP_01896326.1| peptide release factor-glutamine N5-methyltransferase [Moritella
           sp. PE36]
 gi|149809249|gb|EDM69178.1| peptide release factor-glutamine N5-methyltransferase [Moritella
           sp. PE36]
          Length = 279

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 127/242 (52%), Gaps = 14/242 (5%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D V+DD      T  I+R    E +  ILG+R+F+++ L +S+DT  PRP+TE+LV+ AL
Sbjct: 45  DKVMDDDIIRRFTALIMRRQAGEPVAHILGYREFWSLELEVSADTLIPRPDTEILVEQAL 104

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
           A  +P        ++LDLGTGTGA+ LAL  ESP      ++    A  +A+ N    G 
Sbjct: 105 A-CMP----THACQVLDLGTGTGAIALALASESPQATVTAIEYQQGAAALARRNVKRCG- 158

Query: 147 SERFD--TLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
              FD   LQ  WF  ++    FDVIVSNPPYI++        +VR F+P  +L    +G
Sbjct: 159 ---FDVTVLQGSWFEPLKASQRFDVIVSNPPYIDAHDPHLAMGDVR-FEPLTALVAADNG 214

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           L+  + I     + L  DG   VE G+ Q   V  +F +     V   KDYG NDR+ + 
Sbjct: 215 LADLKHIISQGYQFLTVDGWLLVEHGFEQGAAVRALFTASNYHQVVTHKDYGNNDRITVG 274

Query: 263 CR 264
            R
Sbjct: 275 QR 276


>gi|262372380|ref|ZP_06065659.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter junii SH205]
 gi|262312405|gb|EEY93490.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter junii SH205]
          Length = 272

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 137/259 (52%), Gaps = 12/259 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  + G++S ++ +  +  L + Q     N + R    E +  + G + F+ + 
Sbjct: 19  QEAAWLLEHILGINSLELKLRLEQELTEIQEQAYLNGLARIDHGEPLAYVTGSQPFWTLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP+TE+L+++ L     ++E      ++DLGTGTGA+ LAL  E P +K 
Sbjct: 79  LKVTHDTLVPRPDTEILIETVL-----KLELDSTSNVVDLGTGTGAIALALASERPQWKV 133

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
              DI    LE+A+ NA+ +G++  +F      WF ++E   FD+IVSNPPYI+    + 
Sbjct: 134 TATDIYQPTLEVAQENAIRHGLTHVKFAC--GAWFDALEKQFFDLIVSNPPYIDP---ED 188

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           + +++   +P  +L     GL+   TI       LN +G   +E GY+Q   V  +FE  
Sbjct: 189 VHMQMLKSEPERALIADKQGLADLETIIVQGKSWLNPNGWIVLEHGYDQGEAVRTMFEKE 248

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   KDYGGNDRV L
Sbjct: 249 GFSQIQTIKDYGGNDRVSL 267


>gi|152997600|ref|YP_001342435.1| HemK family modification methylase [Marinomonas sp. MWYL1]
 gi|150838524|gb|ABR72500.1| modification methylase, HemK family [Marinomonas sp. MWYL1]
          Length = 282

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 139/260 (53%), Gaps = 12/260 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLD--DRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L  V  +S+      P+ ++   D +RF     + R    E +  +LG + F+N+
Sbjct: 24  DAQLLLAHVLAVSTSYFYTWPEKLVSTSDVERF--NGLLARRELGEPVAYLLGQQAFWNL 81

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            L ++  T  PR +TE LV+ AL+     ++   V RILDLGTGTGA+ L+L  E P   
Sbjct: 82  DLEVAPCTLIPRADTERLVEVALSV----LDISKVNRILDLGTGTGAIALSLASEQPKST 137

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL--FDVIVSNPPYIESVIVD 181
            +GVD+   A+ +AK NA+ N +S   D LQS WF ++EG   FD+IVSNPPYI+     
Sbjct: 138 VMGVDLVEDAVALAKRNALRNKLS-NVDFLQSSWFDALEGCEPFDLIVSNPPYIDPDDEH 196

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L     G++    I +   + + ++     E GY+Q   V + F  
Sbjct: 197 LSQGDVR-FEPKSALVADNHGMADIEHIIEVAPKFMQQNAYLMFEHGYDQAASVRKCFIE 255

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V +F+D+GGNDRV +
Sbjct: 256 AGFAAVESFQDFGGNDRVTI 275


>gi|91228928|ref|ZP_01262826.1| HemK protein [Vibrio alginolyticus 12G01]
 gi|91187511|gb|EAS73845.1| HemK protein [Vibrio alginolyticus 12G01]
          Length = 284

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 132/260 (50%), Gaps = 9/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+      + R L  E +  I+G R+F+++  
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEAEQKSQFDALLERRLTGEPVAYIIGEREFWSLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +           +LDLGTGTGA+ +AL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTY-----EQTGPVLDLGTGTGAIAIALASEMPKRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDCL 183
           GVD+  +A  +A+ NA    + +     Q  WF  + EG  F +IVSNPPYI+       
Sbjct: 144 GVDLKQEAKALAEYNAEQLNI-KNVTFAQGSWFEPITEGTKFALIVSNPPYIDEKDPHLS 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +GL+  R I+D   ++L   G  + E GY+Q   V  I     
Sbjct: 203 QGDVR-FEPKSALVAKENGLADIRHISDLARQYLEVGGWLAFEHGYDQGEAVREIMRGFG 261

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              V   KDYGGNDRV L C
Sbjct: 262 YQQVATEKDYGGNDRVTLGC 281


>gi|224824643|ref|ZP_03697750.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lutiella nitroferrum 2002]
 gi|224603136|gb|EEG09312.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lutiella nitroferrum 2002]
          Length = 270

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 129/258 (50%), Gaps = 10/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   L +VTG +  +++  P+  L   Q         R L  E I  +LG R+FY    
Sbjct: 16  ESRLLLMQVTGFTPAKLVGYPELELSPVQEAAFAALAERRLSGEPIAYLLGEREFYGRLF 75

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S     PRPETE LV++ALA    R+  R   +++DLG G+GA+ + L  E+P ++  
Sbjct: 76  LVSPAVLIPRPETEHLVEAALA----RV-GRSPAQVVDLGCGSGAIAVTLALEAPHWQVS 130

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCL 183
            VD+S  AL IA+ NA        F   Q  W++ +    +FD+IVSNPPYI +      
Sbjct: 131 AVDVSDAALAIARQNAARLMAPVTF--FQGSWYAPLPPAAVFDLIVSNPPYIAAADRHLE 188

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    DGLS  R IA G    L   G   VE GY+Q   V  +F +  
Sbjct: 189 QGDVR-FEPRRALTDEDDGLSCLREIAAGAPERLLPGGWLMVEHGYDQGDAVRALFHAVG 247

Query: 244 LFLVNAFKDYGGNDRVLL 261
           L  V    D  G DRV L
Sbjct: 248 LAEVETLPDLAGLDRVTL 265


>gi|240147056|ref|ZP_04745657.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseburia intestinalis L1-82]
 gi|257200779|gb|EEU99063.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseburia intestinalis L1-82]
 gi|291538248|emb|CBL11359.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseburia intestinalis XB6B4]
          Length = 281

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 120/220 (54%), Gaps = 8/220 (3%)

Query: 41  AIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR 100
           A+ +  +H  +  I+G  +F  ++  ++S+   PR +TE LV+ AL    P +      +
Sbjct: 60  ALRKRAEHVPLQYIVGEAEFMGLKFKVNSNVLIPRQDTETLVEEALKVVKPGM------K 113

Query: 101 ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS 160
           +LDL TG+G + ++++   P  +G   DIS +AL +AK NA  N VS  F+  +SD F +
Sbjct: 114 VLDLCTGSGCIIVSIVHNVPEVEGTATDISKQALLVAKENAKLNQVSVTFE--RSDLFDN 171

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           V G +DVIVSNPPYI +  V  L  EV++F+P  +LDG  DGL  YR I      +L   
Sbjct: 172 VTGTYDVIVSNPPYIRTGEVVKLMPEVQEFEPMEALDGKEDGLYFYRKIIKECKAYLKPG 231

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           G    EIGY+Q   V  + +      V   KD   NDRV+
Sbjct: 232 GHILFEIGYDQGEAVSGLLKEAGFKNVTVIKDLAHNDRVV 271


>gi|192359316|ref|YP_001981173.1| methyltransferase, HemK family [Cellvibrio japonicus Ueda107]
 gi|190685481|gb|ACE83159.1| methyltransferase, HemK family [Cellvibrio japonicus Ueda107]
          Length = 265

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 131/255 (51%), Gaps = 4/255 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D    LC +   +   +   PD +L D         + R    E I  I+G R+F+++ L
Sbjct: 8   DIELILCHLLQKNRTWLYTWPDHLLADESLRQFETCLARRETGEPIAHIIGEREFWSLPL 67

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +++ T  PRP+TE++V+  LA S        V R LDLGTGTGA+ LAL  E   ++ +
Sbjct: 68  LVNNSTLIPRPDTEVVVEQVLA-SFAEDAPTQVRRCLDLGTGTGAIALALANEKKHWQVL 126

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLG 184
            VD S  A+ +A++N V          L SDWFS++    FDVIVSNPPYI+        
Sbjct: 127 AVDRSADAVALARTN-VARLRLPNVQVLCSDWFSAIPAQTFDVIVSNPPYIDPQDPHLEQ 185

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+PR +L  G  GL+    I +    +L   G   +E GY+Q   V  +F +  L
Sbjct: 186 GDVR-FEPRSALVAGNAGLADIEAILEQAPAYLAVGGWLLIEHGYDQGRAVRNLFCASGL 244

Query: 245 FLVNAFKDYGGNDRV 259
             V+  +DY GN+RV
Sbjct: 245 VQVSTRRDYAGNERV 259


>gi|114561907|ref|YP_749420.1| modification methylase, HemK family protein [Shewanella
           frigidimarina NCIMB 400]
 gi|114333200|gb|ABI70582.1| modification methylase, HemK family protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 284

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 127/237 (53%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L   Q    +  I +      +  I+G R+F+++   ++  T  PRP+TE+LV++A
Sbjct: 50  PERQLTSEQFKAYSQMIAKRQSGTPVAHIIGEREFWSLPFIVNESTLIPRPDTEILVETA 109

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  S+     R   ++LDLGTGTGA+ LAL  E P ++   +D   +A+E+AK+N     
Sbjct: 110 LNLSV-----RHNAKVLDLGTGTGAIALALASERPKWRITAIDKVPEAVELAKANRGNLN 164

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++E  + +QSDWFS+VE   FD+IVSNPPYI+         +VR F+P+ +L  G +G +
Sbjct: 165 LTE-VEIIQSDWFSAVEQRDFDLIVSNPPYIDEADEHLHLGDVR-FEPQSALTAGNEGYA 222

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
               IA+    HL   G   +E GY Q + V           V   +D+G NDR  L
Sbjct: 223 DLYYIAEQARAHLLPGGYLLLEHGYEQAIKVREKLIELGYQNVATVRDFGSNDRCTL 279


>gi|241667854|ref|ZP_04755432.1| HemK family modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876396|ref|ZP_05249106.1| modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842417|gb|EET20831.1| modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 285

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 136/258 (52%), Gaps = 12/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V  +    + ++ D  LD+     +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLSVDKTYLYLNSDKQLDNAILTKINGKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE++V    A  L  I+ ++  ++ILDLG G+GA+ LAL  E P  +
Sbjct: 86  LYVTKDTLIPRADTEVIV----AAVLDDIQDKNAQLKILDLGAGSGAIALALADELPRSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
            V VD+  K L++AK NA+ N +    + +QS W+ +++G  FD+IVSNPPYI+   VD 
Sbjct: 142 VVAVDLYSKTLDVAKKNALANKIV-NVEFMQSSWYENLDGTKFDIIVSNPPYID---VDD 197

Query: 183 LGLE--VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             ++  VR+ +P  +L    +GL+  R I       L + G   +E G+ Q  D+  IF 
Sbjct: 198 ANIDDSVREHEPSRALFAADNGLADIRIIISQAGGFLKQGGYLYIEHGFTQANDIANIFS 257

Query: 241 SRKLFLVNAFKDYGGNDR 258
                 +   KD    DR
Sbjct: 258 QYSFGDIQTIKDLNYKDR 275


>gi|304397560|ref|ZP_07379437.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pantoea sp. aB]
 gi|304354732|gb|EFM19102.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pantoea sp. aB]
          Length = 276

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 135/259 (52%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   ++VL D Q   L + + R  + E +  ++G R+F+++ 
Sbjct: 22  RDAEILLGYVTGKSRSWLIAFDETVLSDEQLAQLNSLLARRARGEPVAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++  T  PRP+TELLV+ ALA  LP         ILD+GTGTGA+ LAL  E P  + 
Sbjct: 82  LRVTDATLIPRPDTELLVEQALAH-LPATPS----TILDMGTGTGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
            GVD    A+E+A SNA    +S  RF  L S WF ++    F +IVSNPPYI++     
Sbjct: 137 TGVDRIQAAVELAGSNAQQLSLSNTRF--LLSHWFQALTPQRFSLIVSNPPYIDASDSHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+PR +L     GL+  RT+ +     L   G   +E G+ Q   V  +    
Sbjct: 195 EQGDVR-FEPRSALVADEAGLADLRTLIEQAPAWLLPGGWLLLEHGWQQGEAVATLMRQN 253

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               V    DYGGN RV L
Sbjct: 254 GYHAVETVNDYGGNPRVTL 272


>gi|332188263|ref|ZP_08389991.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sphingomonas sp. S17]
 gi|332011762|gb|EGI53839.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Sphingomonas sp. S17]
          Length = 269

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 129/248 (52%), Gaps = 10/248 (4%)

Query: 17  LSSHQVIVDPDSVLDDRQRFF---LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFE 73
           L +H + ++ +++L D  R         + R    E +  I G R F+ + L +      
Sbjct: 27  LFAHALGIERNALLLDLTRTVPDGFWPLVERREAQEPVAYITGTRGFWTLDLMVGPGALV 86

Query: 74  PRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           PR ++E L+ +AL         R    +LDLGTG G + LALL E    KG+GVD S +A
Sbjct: 87  PRVDSETLIAAALQ----HFGGRRPATLLDLGTGPGTLLLALLDEWRETKGLGVDRSAEA 142

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           L  A++NA   G+++R   +  DW +++ G FD IV+NPPYI +   + L  EV  F+P 
Sbjct: 143 LGYARANAAACGLADRARFVLGDWAAALTGPFDCIVTNPPYIGT--GESLSHEVHGFEPA 200

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L  G DGL  YR +A  + R +   G C VEIG+ Q   V  + E++ L  V   +D 
Sbjct: 201 SALFAGEDGLDDYRKLAPELRRLVAPGGACVVEIGHEQAPAVTGLLEAQGL-RVALHRDL 259

Query: 254 GGNDRVLL 261
           GG  R LL
Sbjct: 260 GGRPRALL 267


>gi|114327272|ref|YP_744429.1| peptide release factor-glutamine N5-methyltransferase
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315446|gb|ABI61506.1| peptide release factor-glutamine N5-methyltransferase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 288

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 124/241 (51%), Gaps = 6/241 (2%)

Query: 24  VDPDSVLDDRQR----FFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETE 79
           +D   +L D +R      L   I R  K E +  ILG R+F+ +   ++ DT  PRP+TE
Sbjct: 38  LDATGLLRDSEREVTLPLLDEWITRRAKREPLAYILGAREFWGLSFAVTPDTLIPRPDTE 97

Query: 80  LLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKS 139
            L++ ALA   P   +  V R+LDLGTGTG + LA L E     G+G+D    A  +A+ 
Sbjct: 98  TLIEYALALRPP--TQGMVRRVLDLGTGTGCLLLAALHEYRQATGLGIDRMQGAAALARR 155

Query: 140 NAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGG 199
           NAV+ G+++R      DW       FD+++SNPPYI    ++ L  +VRD++P  +L  G
Sbjct: 156 NAVSLGMADRAAFCAGDWAFCCADRFDLVLSNPPYIPDRDMEGLMADVRDYEPASALAAG 215

Query: 200 IDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
             G+  YR I   +   L   G+  +E+G  Q+  V  +     L ++    D GG  R 
Sbjct: 216 EGGMEAYRRIIPSLPDLLTPAGVAILELGIGQEDGVGALAAPAGLRVIGCRVDLGGIARA 275

Query: 260 L 260
           L
Sbjct: 276 L 276


>gi|223983552|ref|ZP_03633735.1| hypothetical protein HOLDEFILI_01016 [Holdemania filiformis DSM
           12042]
 gi|223964480|gb|EEF68809.1| hypothetical protein HOLDEFILI_01016 [Holdemania filiformis DSM
           12042]
          Length = 284

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 120/224 (53%), Gaps = 12/224 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R LK E +  +LG+  FY  R  ++ +   PRPETE LV + LA       +   +  +D
Sbjct: 62  RILKQEPMQYVLGYSWFYGYRFQVNENVLIPRPETEELVANILADLDEYFAEAKTIDAVD 121

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-- 161
           +GTG+GA+ L+L KE P  +    DIS +A+E+AK+NA + GV  +F  L  D    V  
Sbjct: 122 IGTGSGAIALSLAKEEPKIRMSATDISAEAVEVAKANAASLGVDVKF--LVGDMAQPVID 179

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            G+  D+++ NPPYI     + L   V+D++P ++L GG DGL  YR +     + L   
Sbjct: 180 AGMKVDLLICNPPYIPQ--EETLEASVKDYEPHVALFGGEDGLKFYRQVFAAAPQVLKDK 237

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVLL 261
            + + EIG+NQK  ++   E RK F        KD  G DR+L 
Sbjct: 238 AMMAFEIGWNQKAALLA--EVRKTFGDVRAEVVKDINGKDRMLF 279


>gi|257462415|ref|ZP_05626829.1| methyltransferase [Fusobacterium sp. D12]
 gi|317060079|ref|ZP_07924564.1| methyltransferase [Fusobacterium sp. D12]
 gi|313685755|gb|EFS22590.1| methyltransferase [Fusobacterium sp. D12]
          Length = 368

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 112/212 (52%), Gaps = 6/212 (2%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  ILG  +FY            PR +TE+LV+ A   SL    +++   ILD+GTG+GA
Sbjct: 155 LQYILGKWEFYGYEFITDERALIPRADTEILVEQAKILSL----EKENPSILDIGTGSGA 210

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIV 169
           + + L KE P  + +G+D S KAL +AK N     V      LQSD F +++G  FD+IV
Sbjct: 211 IAITLAKEVPEAEVLGIDKSEKALSLAKENKEYQLVR-NVSFLQSDLFEALQGQRFDIIV 269

Query: 170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY 229
           SNPPYI     + L  EV+ ++P+ +L    DG S Y+ I    + HL K G    E+GY
Sbjct: 270 SNPPYISQEEYEDLMPEVKKYEPKNALTDEGDGYSFYQKIIQQANSHLQKKGYLLFEVGY 329

Query: 230 NQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            Q   V    E      +   +DYGG+ RV+L
Sbjct: 330 QQAQQVKEWMEEENFEGIYIAEDYGGHQRVVL 361


>gi|257877102|ref|ZP_05656755.1| modification methylase HemK [Enterococcus casseliflavus EC20]
 gi|257811268|gb|EEV40088.1| modification methylase HemK [Enterococcus casseliflavus EC20]
          Length = 285

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 120/217 (55%), Gaps = 8/217 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L+HE    +LG+ +FY  RL ++  T  PRPETE LV++ L     ++     +R++D+G
Sbjct: 65  LQHEPPQYLLGYEEFYGHRLKVTPATLIPRPETEELVENCLT----KLPADQPLRVVDIG 120

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL 164
           TGTGA+ +AL    P +    VD+S +AL +AK NA   G   RF   Q D    V +  
Sbjct: 121 TGTGAIAIALKLARPQWAVSAVDLSAEALAVAKENAAALGAEIRF--FQGDTLEPVADQQ 178

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           +D+IVSNPPYI +     + + VR+ +P+++L     GL+ Y+ +A      L  +G  +
Sbjct: 179 WDLIVSNPPYISAEEWPLMDISVREKEPKMALFAQEQGLAIYKQLAQQAPNCLAPNGQMA 238

Query: 225 VEIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
           +EIG+ Q + V ++F +      V   KD  G DR++
Sbjct: 239 LEIGFQQGLAVQQLFAAAFPNKEVTVVKDLAGQDRMV 275


>gi|77360002|ref|YP_339577.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas haloplanktis TAC125]
 gi|76874913|emb|CAI86134.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas haloplanktis TAC125]
          Length = 279

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 123/237 (51%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+S L   Q+        R L  E +  I+G R+F+++ L +++ T  PRP+TE LV+ A
Sbjct: 46  PESTLSTEQQQQFDTFCQRRLNGEPVAHIIGQREFWSLSLEVNATTLIPRPDTETLVEQA 105

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  ++P   K     +LDLGTGTGA+ LAL  E P ++   VD    A+ +A  N     
Sbjct: 106 LEMAVPSNAK-----VLDLGTGTGAIALALGSEMPTWQITAVDRVADAVALATRNQQRLA 160

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++      QS+WFS++ G  F +IVSNPPYIE+  +     +VR F+P  +L    DGL+
Sbjct: 161 IN-NVQVKQSNWFSALNGEKFHLIVSNPPYIETTDIHLKQGDVR-FEPLSALVADDDGLA 218

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             + I      +L+  G   +E G+ Q   V + F       +   KD G NDRV L
Sbjct: 219 DIKQIITQSRDYLHAKGYLLIEHGFEQSGAVSQFFAQMGFINIKTVKDLGNNDRVTL 275


>gi|163803584|ref|ZP_02197451.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. AND4]
 gi|159172626|gb|EDP57483.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Vibrio sp. AND4]
          Length = 285

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 134/260 (51%), Gaps = 9/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V G     ++  P+  L+  Q+    + + R +  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHVLGKPRTYLLTWPEKALEIEQQAQFDDLLARRIAGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P  + +
Sbjct: 89  KVSPSTLIPRPDTERLVEIALDKTYAQTGP-----ILDLGTGTGAIALALASEMPKRQVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCL 183
           GVD+  +A ++A  NA    + +     Q  WF  +     F +IVSNPPYI+       
Sbjct: 144 GVDLKQEAKDLAHYNASQLNI-KNVTFAQGCWFEPITSGTKFALIVSNPPYIDEQDPHLS 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +GL+  R I+D   ++L   G  + E GY+Q   V  I  +  
Sbjct: 203 QGDVR-FEPKSALVADENGLADIRHISDLARQYLEAGGWLAFEHGYDQGDAVRTIMTNFG 261

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              V   KDYGGNDRV L C
Sbjct: 262 YEQVVTEKDYGGNDRVTLGC 281


>gi|291535753|emb|CBL08865.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Roseburia intestinalis M50/1]
          Length = 281

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 120/220 (54%), Gaps = 8/220 (3%)

Query: 41  AIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR 100
           A+ +  +H  +  I+G  +F  ++  ++S+   PR +TE LV+ AL    P +      +
Sbjct: 60  ALRKRAEHVPLQYIVGEAEFMGLKFKVNSNVLIPRQDTETLVEEALKVVKPGM------K 113

Query: 101 ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS 160
           +LD+ TG+G + ++++   P  +G   DIS +AL +AK NA  N VS  F+  +SD F +
Sbjct: 114 VLDMCTGSGCIIVSIVHNIPEVEGTATDISKQALLVAKENAKLNQVSVTFE--RSDLFDN 171

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           V G +DVIVSNPPYI +  V  L  EV++F+P  +LDG  DGL  YR I      +L   
Sbjct: 172 VTGTYDVIVSNPPYIRTGEVVKLMPEVQEFEPMEALDGKEDGLYFYRKIIKECKAYLKPG 231

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           G    EIGY+Q   V  + +      V   KD   NDRV+
Sbjct: 232 GHILFEIGYDQGEAVSGLLKEAGFKNVTVIKDLAHNDRVV 271


>gi|237744128|ref|ZP_04574609.1| methyltransferase [Fusobacterium sp. 7_1]
 gi|229431357|gb|EEO41569.1| methyltransferase [Fusobacterium sp. 7_1]
          Length = 370

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 128/222 (57%), Gaps = 7/222 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           ++R+ K + +  ILG  +FY +   ++     PR +TE+LV+  +   +  +E+ +   I
Sbjct: 131 VLRAKKRKPLQYILGEWEFYGLPFKVNEGVLIPRADTEILVEQCIQL-MREVEEPN---I 186

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+G+G+GA+ +A+  E       G+DI+ KA+E+A  N   N + E  + ++S+ F  +
Sbjct: 187 LDIGSGSGAISIAIANELKSSSVTGIDINEKAIELAIENKTLNKI-ENVNFIESNLFEKL 245

Query: 162 EGLF--DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           +  F  D+IVSNPPYI       L  EV++++P+ +L    DGL  YR I+     +L  
Sbjct: 246 DKDFKYDLIVSNPPYISKEEYRTLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKD 305

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G  + EIGYNQ  DV +I ++    +++  KDYGGN+RV++
Sbjct: 306 TGYLAYEIGYNQAKDVTKILQNNNFDVLSVIKDYGGNNRVVI 347


>gi|197284959|ref|YP_002150831.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Proteus mirabilis HI4320]
 gi|194682446|emb|CAR42348.1| protein methyltransferase (protein-glutamine N-methyltransferase)
           [Proteus mirabilis HI4320]
          Length = 282

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 137/258 (53%), Gaps = 12/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT  +   +I   ++VL + ++  L++ + R +K E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTKRARTYLIAFSETVLLEDEQVQLSSLLARRIKGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEK--RDVVRILDLGTGTGAVCLALLKESPFF 122
           L +S  T  PRP+TE LV+ AL       EK      RILDLGTGTGA+ LA+  E    
Sbjct: 82  LKVSPATLIPRPDTECLVEKAL-------EKLSAQASRILDLGTGTGAIALAIASERSDC 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVD 181
           + +GVD   +A+ +A  NA    +S   +  +S WFSS+ G  FD+I+SNPPYI+     
Sbjct: 135 RVLGVDFQPEAVALAIENAQHLALS-NVEFTESCWFSSLSGYQFDMIISNPPYIDEEDEH 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L     G +    I     + L  +G   +E G+ Q   V  IF  
Sbjct: 194 LYQGDVR-FEPLTALVAADHGFADIELIITNARQFLANNGWVLIEHGWQQGERVRNIFID 252

Query: 242 RKLFLVNAFKDYGGNDRV 259
           +    V  F+DYGGN+RV
Sbjct: 253 KGYCCVETFRDYGGNERV 270


>gi|157829147|ref|YP_001495389.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933876|ref|YP_001650665.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia rickettsii str. Iowa]
 gi|157801628|gb|ABV76881.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908963|gb|ABY73259.1| peptide release factor-glutamine N5-methyltransferase [Rickettsia
           rickettsii str. Iowa]
          Length = 524

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 132/262 (50%), Gaps = 21/262 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAKIEAFEKLLARRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSALAFSL-----PRIEKRD---------------VVRILDLGTGTGAVCLALLKESPF 121
           VD            P  ++ D                + IL+LGTG+G + ++LL E P 
Sbjct: 103 VDVVFQCHSRESGNPEKKQPDPCFRGNDISKNCNDKFLNILELGTGSGCIAISLLCELPN 162

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
              V  DIS  A++I KSNA    V++R   + S+WF ++E   FD IVSNPPYI     
Sbjct: 163 ANVVATDISLDAIDIIKSNAAKYEVTDRIQIIHSNWFENIETQKFDFIVSNPPYIAHSEK 222

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             + +E  +++P I+L    DGL  Y  IA+   + L  +G   +EIG+ Q+  V +IF 
Sbjct: 223 SEMAIETINYEPSIALFAEKDGLQAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFL 282

Query: 241 SRKLFLVNAFKDYGGNDRVLLF 262
                + + +KD  G+ RV+L 
Sbjct: 283 DHGYNIESVYKDLQGHSRVILL 304


>gi|254787711|ref|YP_003075140.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Teredinibacter turnerae T7901]
 gi|237685052|gb|ACR12316.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Teredinibacter turnerae T7901]
          Length = 277

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 129/257 (50%), Gaps = 9/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V G S   +   P+  L + ++        R    E +  ILG R+F+++  
Sbjct: 24  DTELLLAAVLGKSRTWLFTWPEYNLSEEEQARFAEFFARRRAGEPVAYILGEREFWSLPF 83

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            + + T  PRP+TELLV   +   +P+       R+LDLGTGTGA+ LAL  E      V
Sbjct: 84  FVDASTLIPRPDTELLVSCIVDLPIPK------QRVLDLGTGTGAIALALASELSDAVIV 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLG 184
            VD S +A+++A  N    G +   + LQSDW+S++ +  FDVIV+NPPYI+        
Sbjct: 138 AVDKSPEAVKLALRNQARLGFT-NVEILQSDWYSALGDQHFDVIVANPPYIDEKDTHLGR 196

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+PR +L     GL+  R I      HLN  G   +E G+ Q   V  I   +  
Sbjct: 197 GDVR-FEPRSALVAADKGLADIRHIIVHAVEHLNDGGTLLIEHGWQQDERVAEILAGKGF 255

Query: 245 FLVNAFKDYGGNDRVLL 261
             +  F+D GGN+R  L
Sbjct: 256 LEIRTFQDLGGNNRATL 272


>gi|312897942|ref|ZP_07757355.1| protein-(glutamine-N5) methyltransferase [Megasphaera
           micronuciformis F0359]
 gi|310620976|gb|EFQ04523.1| protein-(glutamine-N5) methyltransferase [Megasphaera
           micronuciformis F0359]
          Length = 284

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 120/220 (54%), Gaps = 8/220 (3%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R+ ++   H ILG + F  +   ++     PRPETELLV++ L        K   VR+LD
Sbjct: 68  RAARYPVAH-ILGIKPFMGLDFIVNEHVLVPRPETELLVEAVLEIC----PKEVPVRVLD 122

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           +GTG+GA+ L+LL   P   G GVDIS  AL+IA  N+    + +R   + SD F++VE 
Sbjct: 123 MGTGSGAILLSLLSYLPQATGTGVDISSDALKIAAENSEALHI-DRAQWVNSDLFTNVEA 181

Query: 164 L-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
             +D +VSNPPY+ +  +  L  EV+ +DP+ +L GG DGL  YR +A     +L   G 
Sbjct: 182 HEYDWLVSNPPYLTAPDMQNLEKEVK-YDPKTALYGGTDGLDIYRRLASEGGAYLKVGGH 240

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           C VE+G  Q   V  +F  +   LV    DY   +R +L 
Sbjct: 241 CIVEVGAGQARQVAELFTEQDFELVRIINDYADTERHVLL 280


>gi|261340149|ref|ZP_05968007.1| protein-(glutamine-N5) methyltransferase [Enterobacter cancerogenus
           ATCC 35316]
 gi|288317664|gb|EFC56602.1| protein-(glutamine-N5) methyltransferase [Enterobacter cancerogenus
           ATCC 35316]
          Length = 276

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 134/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q   L+  + R    E +  ++G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKTRTWLLAFGETALTAEQEAALSALLARRKTGEPVAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S+ T  PRP+TE LV+ ALA    R+ ++    ILDLGTGTGA+ LAL  E P    
Sbjct: 82  LYVSAATLIPRPDTECLVEQALA----RLPEQSTA-ILDLGTGTGAIALALASERPDCSV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A+ N    G+      LQS WFS++E   F +IVSNPPYI+       
Sbjct: 137 TAVDLMPDAVALAQRNVQRLGLC-NVTVLQSRWFSALEARSFGMIVSNPPYIDENDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +GL+    I     +HL   G   VE G+ Q   V  +F    
Sbjct: 196 QGDVR-FEPRTALVASGEGLADLDHIVTTSRQHLLHGGWLLVEHGWTQGEAVRDLFTRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YTGVETCRDYGGNERLTL 272


>gi|290969300|ref|ZP_06560825.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290780806|gb|EFD93409.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 290

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 124/217 (57%), Gaps = 7/217 (3%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG 109
           ++  I G + F+     +S +   PRPETELLV+    + +   ++R+ +RILD+GTG+G
Sbjct: 73  AVAHITGVKAFFGSDFLVSPEVLIPRPETELLVE----YVIHACKQRESLRILDIGTGSG 128

Query: 110 AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVI 168
           A+ L+LL   P   G GVDIS  AL+IA+ N++  G+  R    +SD    V+G  F VI
Sbjct: 129 AILLSLLAHLPQAVGWGVDISRAALQIAEKNSIVQGLETRAVWRESDLCQQVQGERFSVI 188

Query: 169 VSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG 228
           VSNPPY+ +  +  L  E+R  +P  +L GG DGL  YR +A      L   GLC+VEIG
Sbjct: 189 VSNPPYLTAADMAQLQPEIRR-EPETALFGGQDGLDIYRRLAVETVPLLEPGGLCAVEIG 247

Query: 229 YNQKVDVVRIFESRKLF-LVNAFKDYGGNDRVLLFCR 264
             Q+  V R+F +   + L +   DYG   R L+F +
Sbjct: 248 RGQEEAVQRLFTADGDYTLQDCVWDYGRILRHLVFKK 284


>gi|237731779|ref|ZP_04562260.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Citrobacter sp. 30_2]
 gi|226907318|gb|EEH93236.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Citrobacter sp. 30_2]
          Length = 277

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L + QR  L   + R  + E +  + G R+F+++ 
Sbjct: 22  RDAEILLEFVTGKGRTFILAFGETELTEAQRQQLDTLLERRQRGEPVAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P    
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----ASACRILDLGTGTGAIALALATERPDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  N    G++     LQS+WFS+++G  FD+IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVALAIRNKQQLGINN-VCVLQSNWFSALQGQQFDMIVSNPPYIDEQDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I D   R L   G   +E G+ Q   V   F    
Sbjct: 196 QGDVR-FEPLSALVAGDQGLADIVHIIDQSLRMLTPGGYLLLEHGWQQGEAVRDAFTRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YLAVETCRDYGGNERITL 272


>gi|118602770|ref|YP_903985.1| HemK family modification methylase [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|118567709|gb|ABL02514.1| [protein release factor]-glutamine N5-methyltransferase [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
          Length = 261

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 14/207 (6%)

Query: 56  GWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLAL 115
           G + FY++   ++  T  PRPETELL+D AL       +K    ++LDLGTG+G + + L
Sbjct: 64  GTKGFYHLDFKVTPSTLIPRPETELLIDIALGL----FDKNQTCKVLDLGTGSGIIIITL 119

Query: 116 LKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPY 174
             ++P +     D S  AL+IA+ NA TN      +     WF +    +FD+I+SNPPY
Sbjct: 120 GDKNPQWHLTATDSSINALDIAQQNAKTN-----INFQLGSWFKATPNQIFDLIISNPPY 174

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I+        L    F+P+ +L  G DGL   RTI +   +HLNK G   +E G++Q+ +
Sbjct: 175 IKQSDPHLNDLS---FEPQSALVSGKDGLDDIRTIINNAPQHLNKKGYILLEHGFDQQQE 231

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVLL 261
           ++++  S   F +  FKDY   DR LL
Sbjct: 232 IIQLL-SNNFFNIQKFKDYNQQDRALL 257


>gi|52425246|ref|YP_088383.1| HemK protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307298|gb|AAU37798.1| HemK protein [Mannheimia succiniciproducens MBEL55E]
          Length = 340

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 146/273 (53%), Gaps = 17/273 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +I   D++L + +   L+  +VR  + E I  ILG +DF+++ L
Sbjct: 66  DANRLLQFVTQKSKGTIIAFSDTLLTENESALLSQYLVRRCEGEPIAYILGEQDFWSLNL 125

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV---VRILDLGTGTGAVCLALL------ 116
            +S DT  PRP+TE+LV+ AL F+  R+        + ILDLGTGTGA+ LAL       
Sbjct: 126 EVSPDTLIPRPDTEILVEKALEFAKFRLNSPHFSGELAILDLGTGTGAIALALAAELAPI 185

Query: 117 --KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPP 173
             K     + +GVD++  A+E+AK NA+ N + +  + LQS+WF  +E   FD+IV NPP
Sbjct: 186 SQKCGAKLRILGVDLTNGAVELAKRNALRNQLPQ-VEFLQSNWFEQLENRQFDIIVGNPP 244

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI+         +VR F+P  +L     G +  R I +    HL   G   +E G+ Q  
Sbjct: 245 YIDRQDEHLALGDVR-FEPLTALVAEDSGYADLRHIIERAPFHLKHQGWLILEHGWQQGQ 303

Query: 234 DVVRIFE--SRKLF-LVNAFKDYGGNDRVLLFC 263
            V  IF   S+  +  V   KDYG N+R+ L C
Sbjct: 304 KVRSIFNEFSQNYWQQVATMKDYGDNERITLGC 336


>gi|283785499|ref|YP_003365364.1| protein methyltransferase hemk (protein-glutamine N
           methyltransferase) [Citrobacter rodentium ICC168]
 gi|282948953|emb|CBG88556.1| protein methyltransferase hemk (protein-glutamine N
           methyltransferase) [Citrobacter rodentium ICC168]
          Length = 278

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 131/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L D Q+  L   + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEFVTGKTRTWILAFGETALTDTQQQQLATLLARRRRGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P    
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----ASPCRILDLGTGTGAIALALATERPDCVI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA    +      LQSDWFS+V+G  FD+IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVALAQRNAAHLAIGN-VRILQSDWFSAVKGEQFDMIVSNPPYIDEQDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  G++    I       L+  G   +E G+ Q   V   F    
Sbjct: 196 EGDVR-FEPLSALVAGDHGMADIVQIIAQARDFLSAGGFLLLEHGWQQGAAVREAFSRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 255 YQAVATCRDYGDNERITL 272


>gi|119775697|ref|YP_928437.1| hemK family protein [Shewanella amazonensis SB2B]
 gi|119768197|gb|ABM00768.1| hemK family protein [Shewanella amazonensis SB2B]
          Length = 285

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/237 (35%), Positives = 125/237 (52%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L   Q       I R  K   +  ILG R+F++++  ++  T  PRP+TE+LV++A
Sbjct: 48  PERPLTSEQWKHFEQLINRRAKGVPVAHILGEREFWSLKFLVNETTLIPRPDTEMLVETA 107

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L   LP     D  R+LD+GTGTGA+ LAL  E P ++   +D    A+ +AK+N    G
Sbjct: 108 LNLPLP-----DNARVLDMGTGTGAIALALASERPNWRITALDKVDDAVALAKANREQLG 162

Query: 146 VSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           +S+  + LQSDWFS+V +  FD+IVSNPPYI+         +VR F+P  +L    +G +
Sbjct: 163 LSQ-VEILQSDWFSAVRDADFDLIVSNPPYIDEHDEHLAMGDVR-FEPLSALTAADEGYA 220

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
               IA     HL   G   +E G+ Q + +     S     V   +D+G NDR  L
Sbjct: 221 DLNHIAMHAREHLKVGGYLLLEHGFAQALKLRETLVSLGYDKVATVRDFGSNDRCTL 277


>gi|331090677|ref|ZP_08339526.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330400091|gb|EGG79742.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 274

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (52%), Gaps = 8/255 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  +T +S      +P   +   Q+      +    K   +  +   ++F  +  
Sbjct: 25  DAWILLEYITKISRAMYYANPKREMTGEQKTQYKYFVEERAKRIPLQHLTKEQEFMGLSF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PR +TE+LV++ L       +  + +R+LD+ TG+G + ++LLK     KGV
Sbjct: 85  EVNEHVLIPRQDTEVLVETVLE------DLEENMRVLDICTGSGCILISLLKIMRGVKGV 138

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS +ALE+A+ NA  + +   F  +QSD F +VEG +DVIVSNPPYI++  ++ L  
Sbjct: 139 GVDISEEALEVARRNAQKHDMEAVF--IQSDLFENVEGTYDVIVSNPPYIKTEEIEKLEE 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           EV+  DP ++LDG  DGL  YR I     ++L ++G    EIG  Q  +V  + E     
Sbjct: 197 EVKLHDPMLALDGKEDGLYFYRKIIKESRKYLKRNGKLYFEIGNTQGEEVKTLMEEEGFT 256

Query: 246 LVNAFKDYGGNDRVL 260
            V   KD  G DRV+
Sbjct: 257 NVKIKKDLAGLDRVV 271


>gi|89070965|ref|ZP_01158191.1| modification methylase, HemK family protein [Oceanicola granulosus
           HTCC2516]
 gi|89043472|gb|EAR49686.1| modification methylase, HemK family protein [Oceanicola granulosus
           HTCC2516]
          Length = 289

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 119/255 (46%), Gaps = 21/255 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
            ++ P+ V  D    +    I R   HE +  + G R FY     ++ D  +PRPETE L
Sbjct: 43  TLILPEPVPADALAIY-RQLITRRAAHEPVSHLTGRRMFYGREFLVTPDVLDPRPETETL 101

Query: 82  VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKE-----SPFFKGVGVDISCKALEI 136
           +++ALA            ++LDLG G+G + L LL E      P   G GV++S  A E+
Sbjct: 102 IEAALA--------EPFAQVLDLGMGSGCILLTLLAEMEAMGHPEVWGAGVELSPAAFEV 153

Query: 137 AKSNAVTNGVSERFDTLQSDWFSSVEGLFD-------VIVSNPPYIESVIVDCLGLEVRD 189
           A  N     + ER   LQ  W++ +   F        +IVSNPPY+       L   VR+
Sbjct: 154 AWWNRNAFRLEERALLLQGSWYAPLAAEFGADMPGFALIVSNPPYVTEDEWQALDATVRE 213

Query: 190 FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNA 249
            +PRI+L  G DGL+ YR I      HL   G   VEIG  Q + V  +     L  V  
Sbjct: 214 HEPRIALTDGADGLTAYREIVASAPAHLAPRGRLMVEIGPAQGMAVAALMLEAGLSDVRI 273

Query: 250 FKDYGGNDRVLLFCR 264
            +D  G DRV+L  R
Sbjct: 274 VQDLDGRDRVVLGRR 288


>gi|257867024|ref|ZP_05646677.1| modification methylase HemK [Enterococcus casseliflavus EC30]
 gi|257873359|ref|ZP_05653012.1| modification methylase HemK [Enterococcus casseliflavus EC10]
 gi|257801080|gb|EEV30010.1| modification methylase HemK [Enterococcus casseliflavus EC30]
 gi|257807523|gb|EEV36345.1| modification methylase HemK [Enterococcus casseliflavus EC10]
          Length = 285

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 120/217 (55%), Gaps = 8/217 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L+HE    +LG+ +FY  RL ++  T  PRPETE LV++ L     ++     +R++D+G
Sbjct: 65  LQHEPPQYLLGYEEFYGHRLKVTPATLIPRPETEELVENCLT----KLPADQPLRVVDIG 120

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL 164
           TGTGA+ +AL    P +    VD+S +AL +AK NA   G   RF   Q D    V +  
Sbjct: 121 TGTGAIAIALKLARPQWAVSAVDLSAEALAVAKENAAALGAEIRF--FQGDTLEPVADQQ 178

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           +D+IVSNPPYI +     + + VR+ +P+++L     GL+ Y+ +A      L  +G  +
Sbjct: 179 WDLIVSNPPYISAEEWPLMDISVREKEPKMALFAQEQGLAIYKQLAQQAPNCLAPNGQMA 238

Query: 225 VEIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
           +EIG+ Q + V ++F +      V   KD  G DR++
Sbjct: 239 LEIGFQQGLVVQQLFAAAFPNKEVTVVKDLAGQDRMV 275


>gi|330813116|ref|YP_004357355.1| methylase of polypeptide chain release factors [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486211|gb|AEA80616.1| methylase of polypeptide chain release factors [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 284

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 134/258 (51%), Gaps = 6/258 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           DS   L  V       +    + +L+  Q   ++  I R    E +  IL  +DF+N   
Sbjct: 26  DSEIILASVLKTDRINLSTQHNLILNKSQELLMSQLIERRKNKEPVAYILNKKDFWNETY 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIE-KRDVVRILDLGTGTGAVCLALLKESPFFKG 124
            +      PRPETE+L++      L +I+ K  V+++LD+G G+G + ++ L+E     G
Sbjct: 86  FVDQRALIPRPETEILIE----MVLKKIKDKSKVLQLLDIGCGSGCLLISCLRELKKSIG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCL 183
           +G+DIS  AL ++K N     +++R +  +   F  +    FDVI+SNPPY+ S   D L
Sbjct: 142 IGLDISSDALAVSKINVKNYKLNKRVELHKESIFHFLTLKKFDVILSNPPYLSSAEYDNL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
            ++V++F+P+ +L GG DG SHY+ I    S  L K+GL ++E+G  Q   +  I     
Sbjct: 202 EIDVKNFEPKTALKGGHDGTSHYKKIITFASMSLKKNGLLALELGDQQFFKIKEILAENS 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
             +++ ++   G  R +L
Sbjct: 262 FRVLDKYRLINGEIRCIL 279


>gi|91776826|ref|YP_546582.1| HemK family modification methylase [Methylobacillus flagellatus KT]
 gi|91710813|gb|ABE50741.1| [protein release factor]-glutamine N5-methyltransferase
           [Methylobacillus flagellatus KT]
          Length = 284

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 123/241 (51%), Gaps = 7/241 (2%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           +I   D  + D  R    + + R ++ E +  ILG R+FY     ++ DT  PR +TE L
Sbjct: 46  LIAHGDEAVTDALRARFESLLARRIEGEPVAHILGRREFYGRDFIVTPDTLIPRSDTETL 105

Query: 82  VDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNA 141
           V++A    L RI       ILD+GTGTGA+ + L  E P  K   VD S  AL IA+ NA
Sbjct: 106 VEAA----LDRIPVGQTCEILDMGTGTGAIGITLALERPQAKVTIVDYSEAALAIARENA 161

Query: 142 VTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGI 200
                +     L+SDWFS++ G  FD+IVSNPPYIE+        ++R F+P  +L  G 
Sbjct: 162 -RQLSAHNVTALRSDWFSALGGRCFDLIVSNPPYIEAADPHLQQGDLR-FEPIAALASGA 219

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           DGL   R ++   + HL  +G   +E GY Q   V  + +      +    D  G++RV 
Sbjct: 220 DGLDDIRILSAQAADHLITNGWLMLEHGYQQGAAVRSLLQQHGFANIGTATDLAGHERVT 279

Query: 261 L 261
           L
Sbjct: 280 L 280


>gi|315649891|ref|ZP_07902973.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus vortex V453]
 gi|315274690|gb|EFU38072.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus vortex V453]
          Length = 296

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 134/270 (49%), Gaps = 10/270 (3%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           M+  R++   L  V GLS     +          R  L  AI R  +      I+G ++F
Sbjct: 31  MEPQRNAQLLLEHVLGLSGSSYYMALPEPFPAECRHALEEAIRRKAEGVPAQYIIGEQEF 90

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFS---LPRIEKRDVVRILDLGTGTGAVCLALLK 117
           Y     ++     PRPETELLV++ L +     PR E R  ++ +D+GTG+GA+ + L  
Sbjct: 91  YGRPFEVTPAVLIPRPETELLVEAVLKYGQELAPRSEAR--LKAIDIGTGSGAIAVTLAL 148

Query: 118 ESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF-DVIVSNPPYIE 176
           ++P ++ +  DIS +ALE+A  NA     +  F   Q +      GL  D++VSNPPYI 
Sbjct: 149 QAPSWELLASDISPEALEVATRNAKQLHANVEFR--QGNLLEPFAGLAPDILVSNPPYIP 206

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           +  ++ L  EVRD++PR +LDGG DGL+ YR +   +        L + E+G  Q  DV 
Sbjct: 207 AEDIEGLQPEVRDYEPRTALDGGRDGLNPYRIMMAQLPLLSAPPRLIAFELGMGQAGDVA 266

Query: 237 RIFESRKLFL-VNAFKDYGGNDR-VLLFCR 264
            +      +  +    D  G DR VL  CR
Sbjct: 267 ELLRQAGHWQEIVTVPDLAGIDRHVLGICR 296


>gi|293395775|ref|ZP_06640057.1| protein methyltransferase HemK [Serratia odorifera DSM 4582]
 gi|291421712|gb|EFE94959.1| protein methyltransferase HemK [Serratia odorifera DSM 4582]
          Length = 276

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 139/263 (52%), Gaps = 14/263 (5%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L  VTG +   ++   +++L  ++   L   ++R  + E +  ++G R+F++
Sbjct: 20  AKRDAEILLGFVTGRARTFLLAFGETLLTTQESAQLEQLLMRRERGEPVAYLIGEREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLP--RIEKRDVVRILDLGTGTGAVCLALLKESP 120
           + L++S  T  PRP+TE LV+ ALA  LP  R E      ILDLGTGTGA+ LAL  E  
Sbjct: 80  LPLSVSPATLIPRPDTECLVEQALA-RLPAHRCE------ILDLGTGTGAIALALASERA 132

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESV 178
                GVD+  +A+ +A+ NA    +   +F   Q DWF+ V G  FD+I SNPPYI+  
Sbjct: 133 DCMVTGVDLQPQAVALAQHNAQKLAIGNVQFH--QGDWFTPVAGRRFDLIASNPPYIDGD 190

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
            V     +VR F+P  +L     GL+  R I     R+L   G   +E G+ Q   V  +
Sbjct: 191 DVHLSQGDVR-FEPGSALVAQEHGLADLRAIVQQAPRYLQPQGWLLLEHGWQQAESVRAM 249

Query: 239 FESRKLFLVNAFKDYGGNDRVLL 261
             +     + + +DYGGN RV L
Sbjct: 250 LAAAGFSAIESCRDYGGNLRVTL 272


>gi|212711978|ref|ZP_03320106.1| hypothetical protein PROVALCAL_03054 [Providencia alcalifaciens DSM
           30120]
 gi|212685500|gb|EEB45028.1| hypothetical protein PROVALCAL_03054 [Providencia alcalifaciens DSM
           30120]
          Length = 277

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 135/260 (51%), Gaps = 8/260 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L   TG S   ++   ++ L   ++  L   ++R  + E I  I+G R+F++
Sbjct: 20  AKRDAQILLQYTTGRSRTYILAFDETELTSDEQTQLDALLMRREQGEPIAYIVGEREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +S  T  PRP+TE LV+ AL   LP  E     RILDLGTGTGA+ LAL  E P  
Sbjct: 80  LPLYVSPATLIPRPDTECLVEQALV-RLPNAE----CRILDLGTGTGAIGLALASELPNS 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
             VGVD + +A+ +A+ N     +       QSDWF+S+   LFD+IVSNPPYI+   + 
Sbjct: 135 CVVGVDFNPEAVALAQRNQQRLALP-NIQFSQSDWFASLPNELFDMIVSNPPYIDEGDIH 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L     G S    I     ++L + G   +E G+ Q   V ++F  
Sbjct: 194 LSQGDVR-FEPSTALIADNHGFSDLEHIIATSKQYLKQQGWLLLEHGWQQGSTVRKLFNE 252

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V    DYGG +RV L
Sbjct: 253 NGYTNVETCLDYGGKERVSL 272


>gi|167471071|ref|ZP_02335775.1| methyltransferase, HemK family protein [Yersinia pestis FV-1]
          Length = 267

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 133/257 (51%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ +   Q  +L     R  + E I  ++G R+F+++ 
Sbjct: 13  RDAEILLSFVTGKARTYLLAFGETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLP 72

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E      
Sbjct: 73  LSVSSATLIPRPDTECLVEQALA-RLPAMP----CRILDLGTGTGAIALALATERRDCAV 127

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           + VDI+  A+ +A+ NA    + +    LQ  WF  V G F +I SNPPYI++       
Sbjct: 128 IAVDINADAVALARHNAEKLTI-DNVCFLQGSWFEPVSGRFALIASNPPYIDANDPHLNE 186

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L+  G   +E G+ Q   V  + ++   
Sbjct: 187 GDVR-YEPHSALVAAAEGMADLAAIVSQAPGYLDPGGWLMLEHGWQQANAVQELLKNSGF 245

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   KDYG NDRV L
Sbjct: 246 SAVMTCKDYGNNDRVTL 262


>gi|22126174|ref|NP_669597.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis KIM 10]
 gi|45441670|ref|NP_993209.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Microtus str. 91001]
 gi|108807398|ref|YP_651314.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Antiqua]
 gi|108811663|ref|YP_647430.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Nepal516]
 gi|145598395|ref|YP_001162471.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Pestoides F]
 gi|149366050|ref|ZP_01888085.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis CA88-4125]
 gi|162418925|ref|YP_001606877.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Angola]
 gi|165926407|ref|ZP_02222239.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938832|ref|ZP_02227386.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009186|ref|ZP_02230084.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211074|ref|ZP_02237109.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401386|ref|ZP_02306883.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419945|ref|ZP_02311698.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167424706|ref|ZP_02316459.1| methyltransferase, HemK family [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|218929129|ref|YP_002347004.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis CO92]
 gi|229894729|ref|ZP_04509909.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis Pestoides A]
 gi|229897429|ref|ZP_04512585.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898072|ref|ZP_04513223.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229901941|ref|ZP_04517062.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis Nepal516]
 gi|270490876|ref|ZP_06207950.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Yersinia pestis KIM D27]
 gi|294503911|ref|YP_003567973.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Z176003]
 gi|21959138|gb|AAM85848.1|AE013831_11 possible protoporphyrinogen oxidase [Yersinia pestis KIM 10]
 gi|45436532|gb|AAS62086.1| putative protoporphyrinogen oxidase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108775311|gb|ABG17830.1| protoporphyrinogen oxidase [Yersinia pestis Nepal516]
 gi|108779311|gb|ABG13369.1| putative protoporphyrinogen oxidase [Yersinia pestis Antiqua]
 gi|115347740|emb|CAL20655.1| putative protoporphyrinogen oxidase [Yersinia pestis CO92]
 gi|145210091|gb|ABP39498.1| protoporphyrinogen oxidase [Yersinia pestis Pestoides F]
 gi|149292463|gb|EDM42537.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis CA88-4125]
 gi|162351740|gb|ABX85688.1| methyltransferase, HemK family [Yersinia pestis Angola]
 gi|165913195|gb|EDR31818.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165921628|gb|EDR38825.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991741|gb|EDR44042.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208254|gb|EDR52734.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961640|gb|EDR57661.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049082|gb|EDR60490.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056588|gb|EDR66357.1| methyltransferase, HemK family [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229680837|gb|EEO76932.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis Nepal516]
 gi|229689113|gb|EEO81178.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229693766|gb|EEO83815.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702202|gb|EEO90221.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis Pestoides A]
 gi|262361968|gb|ACY58689.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis D106004]
 gi|262365893|gb|ACY62450.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis D182038]
 gi|270339380|gb|EFA50157.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Yersinia pestis KIM D27]
 gi|294354370|gb|ADE64711.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Z176003]
 gi|320015304|gb|ADV98875.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 276

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 133/257 (51%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ +   Q  +L     R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLSFVTGKARTYLLAFGETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E      
Sbjct: 82  LSVSSATLIPRPDTECLVEQALA-RLPAMP----CRILDLGTGTGAIALALATERRDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           + VDI+  A+ +A+ NA    + +    LQ  WF  V G F +I SNPPYI++       
Sbjct: 137 IAVDINADAVALARHNAEKLTI-DNVCFLQGSWFEPVSGRFALIASNPPYIDANDPHLNE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L+  G   +E G+ Q   V  + ++   
Sbjct: 196 GDVR-YEPHSALVAAAEGMADLAAIVSQAPGYLDPGGWLMLEHGWQQANAVQELLKNSGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   KDYG NDRV L
Sbjct: 255 SAVMTCKDYGNNDRVTL 271


>gi|33152003|ref|NP_873356.1| protein-glutamine N-methyl transferase [Haemophilus ducreyi
           35000HP]
 gi|33148225|gb|AAP95745.1| Protein-glutamine N-methyl transferase [Haemophilus ducreyi
           35000HP]
          Length = 290

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 139/257 (54%), Gaps = 6/257 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D++  L  VT  S   +    ++ L   Q   LT  + R  K E I  ILG ++F+++ L
Sbjct: 29  DANLLLQAVTKKSKAMLFAFGETHLSHDQLAELTLLLQRRQKGEPIAYILGEKEFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE +V+ AL ++  R+E++  + ILDLGTGTGA+ LAL  E    K V
Sbjct: 89  KVSKHTLIPRPDTERVVEIALDWAYKRLEQQTNLHILDLGTGTGAIALALASELG-DKAV 147

Query: 126 --GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
              VDI  +A+ +A+ N    G  ++   LQSDWF++++   FD+IVSNPPYI+    + 
Sbjct: 148 ITAVDIKAEAVSLAEENRQHLGF-KQVTFLQSDWFNALQSQQFDLIVSNPPYIDKTDENL 206

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L     GLS    I +    +L   G   +E G+ Q   V + F+  
Sbjct: 207 KLGDVR-FEPLSALVSAQQGLSDLYKIIENAPLYLTAKGALILEHGWQQATAVQQFFQHY 265

Query: 243 KLFLVNAFKDYGGNDRV 259
               + +++DY G DRV
Sbjct: 266 DWDEIQSWQDYAGLDRV 282


>gi|262041833|ref|ZP_06015018.1| protein methyltransferase HemK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040825|gb|EEW41911.1| protein methyltransferase HemK [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 283

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 134/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   +VR  + E I  ++G R+F+++ 
Sbjct: 23  RDAEILLGHVTGRARTWILAFGETTLSADEAARLEALLVRRHRGEPIAHLVGQREFWSLP 82

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 83  LFVSPATLIPRPDTECLVEQALA-RLPTAP----CRILDLGTGTGAIALALASERPDCEV 137

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA   G++      QSDWFS+++G  F  IVSNPPYI++      
Sbjct: 138 TAVDVMPDAVALALRNAEHLGIAN-VTISQSDWFSALDGQRFATIVSNPPYIDAADPHLA 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 197 EGDVR-FEPLTALVAGDQGLADLAHIIREGRQYLQPGGWMLLEHGWTQGEAVRALFREAG 255

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 256 YLDVATCRDYGDNERLTL 273


>gi|237807597|ref|YP_002892037.1| modification methylase, HemK family [Tolumonas auensis DSM 9187]
 gi|237499858|gb|ACQ92451.1| modification methylase, HemK family [Tolumonas auensis DSM 9187]
          Length = 282

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 128/258 (49%), Gaps = 7/258 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  D+   LC V   +   +   P+  L   Q   +    VR  + E +  ILG R+F++
Sbjct: 20  AALDADCLLCAVLSCTRTYLRTWPEQELTPEQVAQVEQFAVRREQGEPVAYILGVREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +S  T  PRP+TE LV+ AL       E+    + LDLGTGTGA+ LAL  E P  
Sbjct: 80  LPLQVSPATLIPRPDTEALVEWALTL---LSEQGQGQKALDLGTGTGAIALALKSEFPAL 136

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVD 181
               ++    AL++A+ NA   G S  F  L S+WFS++ E  F +IVSNPPYI++    
Sbjct: 137 AMWALEREPAALDLARRNAARLGFSVNF--LASNWFSALNERNFQLIVSNPPYIDAADPH 194

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L    DGL+  R I D    +L   G   +E G+ Q   V  +  S
Sbjct: 195 LAQGDVR-FEPHSALVADEDGLADIRQIIDQAPEYLAAGGWLLLEHGWQQAEAVRDLLSS 253

Query: 242 RKLFLVNAFKDYGGNDRV 259
           R    V    D GG DRV
Sbjct: 254 RGFQAVTTKSDLGGQDRV 271


>gi|262274707|ref|ZP_06052518.1| Polypeptide chain release factor methylase [Grimontia hollisae CIP
           101886]
 gi|262221270|gb|EEY72584.1| Polypeptide chain release factor methylase [Grimontia hollisae CIP
           101886]
          Length = 281

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 128/257 (49%), Gaps = 8/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V    S  +    D  L + +       + R    E +  I+G+RDF+++RL
Sbjct: 27  DASVLLCHVLDKPSSYLYTWSDKALTEDEEAAFNTLLARRKTGEPVAYIIGYRDFWSLRL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +   T  PRP+TE LV+ AL     R+ + D   +LDLGTGTGA+ LA+  E       
Sbjct: 87  NVEPSTLIPRPDTERLVELALE----RLPQGDGA-VLDLGTGTGAIALAIASERKDIAVT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
           GVD+  +A+ +A  N + NG++     +QS WFS+V    F +IVSNPPYI+        
Sbjct: 142 GVDLRAEAVALAMKNGLENGINNA-QFMQSSWFSNVPAQRFSMIVSNPPYIDPEDPHLSQ 200

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L  G  GL+  R I      +L   G   +E GY+Q   V  +F     
Sbjct: 201 GDVR-FEPKSALVSGEHGLADIRVICQQSPEYLVDGGWLLIEHGYDQGEAVRTLFCGAGF 259

Query: 245 FLVNAFKDYGGNDRVLL 261
             V    DY G DRV L
Sbjct: 260 IDVETQHDYAGLDRVTL 276


>gi|283856489|ref|YP_163245.2| Modification methylase HemK family protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775493|gb|AAV90134.2| Modification methylase HemK family protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 286

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 137/253 (54%), Gaps = 10/253 (3%)

Query: 17  LSSHQVIVDPDSVL-----DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDT 71
           L +H + ++ D++L     +         AI R  ++E +  ILG+RDF+ +RLT++ D 
Sbjct: 39  LMAHSLGIERDALLLGSWGEKEAPLSFFEAIKRRKQNEPVAYILGYRDFWTLRLTVTPDV 98

Query: 72  FEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISC 131
             PRP++E L+++A+A+   R +      ILDLGTG+GA+ LA L E    KG+GVD S 
Sbjct: 99  LIPRPDSETLIETAIAYF--REQAFLPENILDLGTGSGALLLAALDEWKDAKGLGVDASP 156

Query: 132 KALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFD 191
           +A++IA+ NA   G   R +     W   ++  FD+++ NPPYI    +  +  +V  ++
Sbjct: 157 EAIKIARLNADKCGALPRVEFKIGHWGRGIQQKFDLLLCNPPYIARDAM--MPADVLHYE 214

Query: 192 PRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFK 251
           P ++L  G +GL  YR I  G+   L + G+  +EIG++Q  +V  I +   L     F 
Sbjct: 215 PHLALFSGDEGLDDYREIIPGIPSLLTERGIACLEIGFDQAENVSMIAKETGL-RSRIFY 273

Query: 252 DYGGNDRVLLFCR 264
           D     R +L  R
Sbjct: 274 DLEQRPRCVLLSR 286


>gi|330009866|ref|ZP_08306622.1| protein-(glutamine-N5) methyltransferase [Klebsiella sp. MS 92-3]
 gi|328534692|gb|EGF61257.1| protein-(glutamine-N5) methyltransferase [Klebsiella sp. MS 92-3]
          Length = 283

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 133/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   +VR  + E I  ++G R+F+++ 
Sbjct: 23  RDAEILLGHVTGRARTWILAFGETTLSADEAARLEALLVRRQRGEPIAHLVGQREFWSLP 82

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 83  LFVSPATLIPRPDTECLVEQALA-RLPTAP----CRILDLGTGTGAIALALASERPDCEV 137

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA   G++      QSDWFS ++G  F  IVSNPPYI++      
Sbjct: 138 TAVDVMPDAVALALRNAEHLGIAN-VTISQSDWFSELDGQRFATIVSNPPYIDAADPHLA 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 197 EGDVR-FEPLTALVAGDQGLADLAHIIREGRQYLQPGGWMLLEHGWTQGEAVRALFREAG 255

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 256 YLDVATCRDYGDNERLTL 273


>gi|153868970|ref|ZP_01998684.1| hemK protein [Beggiatoa sp. PS]
 gi|152074464|gb|EDN71316.1| hemK protein [Beggiatoa sp. PS]
          Length = 280

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 136/256 (53%), Gaps = 9/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC +  ++   ++  P+ +L + Q       + R ++   I  ++G + F++  L
Sbjct: 25  DAEILLCHILNVTRSYLLAWPEKILTENQYAQFQALLTRRVQGVPIAYLIGSKAFWSFDL 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ +T  PRPETELLV+  LA    R+      +++DLGTG+GA+ LA+ KE P+ + +
Sbjct: 85  QVTKNTLIPRPETELLVEQVLA----RLPPDSDAQVIDLGTGSGAIALAIAKERPYCRLL 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC-L 183
             D + +AL++A++NA   G       L SDW+S++  +   ++VSNPPY+     DC L
Sbjct: 141 ATDNATEALQVAQANAQHLGF-HPIKFLLSDWWSALGDIKATIVVSNPPYVAE--NDCHL 197

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
                  +PR +L  G+DGL+  R +      HL  +G   +E GY+Q   V ++FE + 
Sbjct: 198 TQGDVHHEPRNALVAGVDGLTDIRALVKESLSHLEINGWLLLEHGYDQGEAVQQLFEQQG 257

Query: 244 LFLVNAFKDYGGNDRV 259
              +  + D  G  RV
Sbjct: 258 YQAIETYYDLAGLPRV 273


>gi|297182636|gb|ADI18794.1| methylase of polypeptide chain release factors [uncultured SAR11
           cluster bacterium HF4000_37C10]
          Length = 279

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 128/226 (56%), Gaps = 9/226 (3%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
             +AI R +  E +  I+G ++F++    ++  T  PRPETELL+   + F      K  
Sbjct: 57  FNHAIKRRINREPVAYIIGKKEFWSQDFAVNHATLVPRPETELLIYKVVDFF-----KNK 111

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV--SERFDTLQS 155
            + ILD+GTG+G + L++LKE  F +GVG+DIS KA++ A+ N+    +    +F     
Sbjct: 112 RINILDIGTGSGCILLSILKELDFSRGVGIDISTKAIKTAQINSKNLNLFHQSKFKVFDI 171

Query: 156 DWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR 215
             F+   G +D+IVSNPPYI S  +  L  ++ +++P ++L+GG+DGL   R +    + 
Sbjct: 172 SKFNV--GKYDLIVSNPPYIPSKDIKNLSKDIINYEPLVALNGGLDGLDLIRKVIYKSNS 229

Query: 216 HLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            L ++GL ++EIG+NQ + V  + +      ++   DY  N R ++
Sbjct: 230 LLKRNGLLAIEIGFNQYLKVSSLLKQYGFREMSRQCDYNHNVRCII 275


>gi|308186586|ref|YP_003930717.1| possible protoporphyrinogen oxidase [Pantoea vagans C9-1]
 gi|308057096|gb|ADO09268.1| possible protoporphyrinogen oxidase [Pantoea vagans C9-1]
          Length = 277

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 135/258 (52%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   ++ L D Q   L + + R  + E +  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRSWLIAFDETALSDAQLAQLDSLLARRARGEPVAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TELLV+ ALA  LP         ILD+GTGTGA+ LAL  E P  + 
Sbjct: 82  LRVSDATLIPRPDTELLVEQALAH-LPATPS----TILDMGTGTGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
            GVD    A+E+A SNA    +S     L S WF ++    F +IVSNPPYI++      
Sbjct: 137 TGVDRIEAAVELAGSNAEQLNLSNT-TFLLSHWFQALTPQHFTLIVSNPPYIDASDTHLE 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L     GL+  RT+ +     L   G   +E G+ Q   V  + ++  
Sbjct: 196 QGDVR-FEPRSALVADEAGLADLRTLIEQAPAWLLPGGWLLLEHGWQQGEAVATLMQNNG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN RV L
Sbjct: 255 YHAVETVRDYGGNPRVTL 272


>gi|167759399|ref|ZP_02431526.1| hypothetical protein CLOSCI_01746 [Clostridium scindens ATCC 35704]
 gi|167662956|gb|EDS07086.1| hypothetical protein CLOSCI_01746 [Clostridium scindens ATCC 35704]
          Length = 283

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 132/275 (48%), Gaps = 40/275 (14%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+   L   TG+S      DPD                + +K E   R LG+ +  
Sbjct: 26  EAALDAWYLLEFATGISKASYYGDPD----------------KEIKEEEAARYLGYIEIR 69

Query: 62  NVRLTLSSDTFE----------------PRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
             R+ L   T E                PR +TE LV+ AL    P ++      +LDL 
Sbjct: 70  KSRIPLQHITKEQAFMGYPFYVDEHVLIPRQDTETLVEEALKVLKPGMQ------VLDLC 123

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+G + ++L+K      G G DIS  ALE+A+ NA    V+  F  ++S  F  + G +
Sbjct: 124 TGSGCILISLMKMCKGLYGTGSDISEDALEVARKNACRLEVNAAF--IRSSLFEHISGRY 181

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI + +++ L  EVR +DP I+LDG  DGL  YR I     R+L  +G    
Sbjct: 182 DLIVSNPPYIPTSVIEGLQEEVRLYDPFIALDGKEDGLYFYREIIKAGIRYLRPEGYLMF 241

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           EIGY+Q  +V  + E +    +   KD  G DRV+
Sbjct: 242 EIGYDQGNEVACLMEKQGYRNILVKKDLAGLDRVV 276


>gi|227355361|ref|ZP_03839762.1| protein methyltransferase (protein-glutamine N-methyltransferase)
           [Proteus mirabilis ATCC 29906]
 gi|227164585|gb|EEI49456.1| protein methyltransferase (protein-glutamine N-methyltransferase)
           [Proteus mirabilis ATCC 29906]
          Length = 282

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 136/258 (52%), Gaps = 12/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT  +   +I   ++VL + +   L++ + R +K E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTKRARTYLIAFSETVLLEDELVQLSSLLARRIKGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEK--RDVVRILDLGTGTGAVCLALLKESPFF 122
           L +S  T  PRP+TE LV+ AL       EK      RILDLGTGTGA+ LA+  E    
Sbjct: 82  LKVSPATLIPRPDTECLVEKAL-------EKLSAQASRILDLGTGTGAIALAIASERSDC 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVD 181
           + +GVD   +A+ +A  NA    +S   +  +S WFSS+ G  FD+I+SNPPYI+     
Sbjct: 135 RVLGVDFQPEAVALAIENAQHLALS-NVEFTESCWFSSLSGYQFDMIISNPPYIDEEDEH 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L     G +    I     + L  +G   +E G+ Q   V  IF  
Sbjct: 194 LYQGDVR-FEPLTALVAADHGFADIELIITNARQFLANNGWVLIEHGWQQGERVRNIFID 252

Query: 242 RKLFLVNAFKDYGGNDRV 259
           +    V  F+DYGGN+RV
Sbjct: 253 KGYCCVETFRDYGGNERV 270


>gi|154482490|ref|ZP_02024938.1| hypothetical protein EUBVEN_00157 [Eubacterium ventriosum ATCC
           27560]
 gi|149736691|gb|EDM52577.1| hypothetical protein EUBVEN_00157 [Eubacterium ventriosum ATCC
           27560]
          Length = 237

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 118/210 (56%), Gaps = 5/210 (2%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  I G ++F  +   ++ D   PR +TELLV++A+ +   +  K DV  +LD+ TG+G 
Sbjct: 28  LQHITGSQEFMGLDFKVNEDVLIPRQDTELLVENAITYI--KSVKGDV-DVLDMCTGSGC 84

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + +++ +     K   VD S KAL +AK N   N     F   QSD F +VE  +DVIVS
Sbjct: 85  IAISIDRLCENAKVTAVDFSEKALVVAKENNALNKADVTF--FQSDLFENVEKQYDVIVS 142

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI++  ++ L  EVR  +P ++LDG  DGL  Y+ IA    ++L  +G+   EIGY+
Sbjct: 143 NPPYIKTEEIESLMDEVRIHEPMMALDGDCDGLKFYKKIAKEGRQYLRSNGIIFFEIGYD 202

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V  I E      +  +KD  GNDRV+
Sbjct: 203 QGQTVPAILEENGYKDIKVYKDLSGNDRVV 232


>gi|323496830|ref|ZP_08101867.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sinaloensis DSM 21326]
 gi|323318089|gb|EGA71063.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sinaloensis DSM 21326]
          Length = 286

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 133/258 (51%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC   G     ++  PD  L   Q       + R +K E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHSLGKPRSFLLTWPDKELTTEQIERFEQLLSRRIKGEPVAYIIGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           +++  T  PRP+TE LV+ AL  +   + + D   ILDLGTGTGA+ LAL  E P  K  
Sbjct: 89  SVAPSTLIPRPDTERLVEVALDKA--NLNQGD---ILDLGTGTGAIALALASELPERKVW 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCL 183
           G+D+   A ++A SNA   G++   +     WF  V+    F +IVSNPPYIE       
Sbjct: 144 GIDLKIDAQQLASSNADKLGIT-NCEFRAGSWFDPVDAGTQFALIVSNPPYIEENDPHLT 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  + I++   R+L   G    E GY+Q   V  I  S  
Sbjct: 203 QGDVR-FEPLSALVAEDNGLADIKHISEHARRYLLAGGWLMFEHGYDQGKAVRDILTSLG 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
            + V  +KDYG NDRV +
Sbjct: 262 YYQVETYKDYGNNDRVTI 279


>gi|116511388|ref|YP_808604.1| methylase of polypeptide chain release factor [Lactococcus lactis
           subsp. cremoris SK11]
 gi|116107042|gb|ABJ72182.1| Methylase of polypeptide chain release factor [Lactococcus lactis
           subsp. cremoris SK11]
          Length = 271

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 123/236 (52%), Gaps = 12/236 (5%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLP 91
           D++   LT    R +K+E    I+GW +FY ++  +      PRPETE LV+  L  +  
Sbjct: 45  DQELNLLTELSERLIKNEPPQYIVGWAEFYELKFKVDERVLIPRPETEELVEMILTEN-- 102

Query: 92  RIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFD 151
                D ++ILD+GTG+GA+ ++L K    +     DIS  ALE+A  NA  N V+  F 
Sbjct: 103 ---NNDSLKILDIGTGSGAIAISLAKARQNWSVKASDISQNALELAAENAKMNHVNLEF- 158

Query: 152 TLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIAD 211
            +QSD    +   FD+IVSNPPYI       +   V  ++P ++L     GL+ Y+ IAD
Sbjct: 159 -IQSDVMDELTDRFDIIVSNPPYIAFDETYEMDDSVIKYEPDLALFAQNQGLAIYQKIAD 217

Query: 212 GVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVLLFCR 264
               HL  DG   +EIGY Q   V  IF+ +  F   LV+  +D  G DR++   R
Sbjct: 218 QAVNHLTDDGKIYLEIGYKQGKAVQAIFQEK--FTDRLVSIHQDIFGKDRMISVKR 271


>gi|317499019|ref|ZP_07957300.1| (glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316893669|gb|EFV15870.1| (glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 283

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 129/241 (53%), Gaps = 10/241 (4%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D + D          I +  +H  +  ILG ++F      ++ D   PR +TE +++  L
Sbjct: 47  DEINDKEAEERYKELIQKRKEHVPLQYILGTQEFMGYTFKVTPDVLIPRADTETVLEEVL 106

Query: 87  AFSLPRIEKRDVVRILDLGTGTG--AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
              +P+  K   ++ILDL TG+G  A+ LAL+ +      VG DIS KAL+IAK+N    
Sbjct: 107 -LKVPQTLKN--LKILDLCTGSGCIAISLALILKPEVC--VGTDISEKALKIAKANGENL 161

Query: 145 GVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
               +F  +QSD F +V G +D+I+SNPPYI +     L  EV+D++P ++LDG  DGL 
Sbjct: 162 APMVKF--IQSDLFENVTGSYDLIISNPPYITTEECGKLMPEVKDYEPMLALDGKEDGLY 219

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL-FC 263
            Y+ I      +LN  G+ + EIGY+Q   V  + E++    V   KD  G DR++  F 
Sbjct: 220 FYKKIIKEAKNYLNPQGMLAFEIGYDQGEAVKNLMEAQDFACVEIKKDLAGLDRLVFGFA 279

Query: 264 R 264
           R
Sbjct: 280 R 280


>gi|167629002|ref|YP_001679501.1| methyltransferase, putative [Heliobacterium modesticaldum Ice1]
 gi|167591742|gb|ABZ83490.1| methyltransferase, putative [Heliobacterium modesticaldum Ice1]
          Length = 297

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 127/236 (53%), Gaps = 10/236 (4%)

Query: 30  LDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           L D Q+  L   I R L    +  I G ++F+ +   ++     PRPETELLV++ALA  
Sbjct: 57  LTDAQQARLGELIQRRLTGCPLQYITGRQEFWGLDFAVTPAVLIPRPETELLVETALAL- 115

Query: 90  LPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS-- 147
           L R ++     I D+G G+GA+ +A+ +E P  + +  D+S  AL +A+ NA  +GV+  
Sbjct: 116 LGRQDR--TAWIADVGVGSGAIAVAMARERPRLQVLATDLSEAALAVARQNAKRHGVAGQ 173

Query: 148 ---ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
               R D L     +++      ++SNPPYI S  +  L  EV  F+P+++LDGG DGL 
Sbjct: 174 IRFARGDLLDPAIDAAIR--LKAVLSNPPYIPSGHIPSLQREVAGFEPKLALDGGEDGLD 231

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            YR +A      L   G  ++EIGYNQ   V  +F ++    +   +D  G+DRV+
Sbjct: 232 LYRRLAFKAGLVLEPGGFVALEIGYNQGEAVSSLFAAQGFRDIGLIRDGQGHDRVV 287


>gi|288905237|ref|YP_003430459.1| methyltransferase [Streptococcus gallolyticus UCN34]
 gi|306831308|ref|ZP_07464468.1| protein-(glutamine-N5) methyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325978213|ref|YP_004287929.1| methyltransferase [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
 gi|288731963|emb|CBI13528.1| putative methyltransferase [Streptococcus gallolyticus UCN34]
 gi|304426544|gb|EFM29656.1| protein-(glutamine-N5) methyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325178141|emb|CBZ48185.1| methyltransferase [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
          Length = 276

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 128/244 (52%), Gaps = 14/244 (5%)

Query: 23  IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLV 82
           I+  +  + ++ +  L   + +  +H S   I G   F ++ L++      PRPETE LV
Sbjct: 40  ILHQNQAITEKDQMLLEQIMAQLTEHRSPQYITGKAYFRDLELSVDERVLIPRPETEELV 99

Query: 83  DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
           D  L     +   R  +R+LD+GTG+GA+ ++L    P ++    DIS  AL++AK NA+
Sbjct: 100 DLVL-----KENSRADLRVLDIGTGSGAIAISLKAARPNWQVTASDISADALQLAKENAL 154

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
            N V      +QSD FS +   FD+I+SNPPYI     D +G+ V   +P ++L    DG
Sbjct: 155 KNQVE--LTLIQSDVFSQITERFDMIISNPPYIAYDDEDEVGINVLASEPHLALFADEDG 212

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQ----KVDVVRIFESRKLFLVNAFKDYGGNDR 258
            + YR I +  S HL ++G    EIGY Q    +  + + F +++   V   KD  G DR
Sbjct: 213 FAIYRQIIENASEHLTENGKLYFEIGYKQGEGLRALLSKHFPAKR---VRVIKDMFGKDR 269

Query: 259 VLLF 262
           +++ 
Sbjct: 270 MVVM 273


>gi|125623425|ref|YP_001031908.1| putative protoporphyrinogen oxidase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124492233|emb|CAL97162.1| putative protoporphyrinogen oxidase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300070172|gb|ADJ59572.1| putative protoporphyrinogen oxidase [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 270

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 122/232 (52%), Gaps = 12/232 (5%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLP 91
           D++   LT    R +K+E    I+GW +FY ++  +      PRPETE LV+  L  +  
Sbjct: 45  DQELNLLTELSERLIKNEPPQYIVGWAEFYELKFKVDERVLIPRPETEELVEMILTEN-- 102

Query: 92  RIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFD 151
                D ++ILD+GTG+GA+ ++L K    +     DIS  ALE+A  NA  N V+  F 
Sbjct: 103 ---NNDSLKILDIGTGSGAIAISLAKARQNWSVKASDISQNALELAAENAKMNHVNLEF- 158

Query: 152 TLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIAD 211
            +QSD    +   FD+IVSNPPYI       +   V  ++P ++L     GL+ Y+ IAD
Sbjct: 159 -IQSDVMDELTDRFDIIVSNPPYIAFDETYEMDDSVIKYEPDLALFAKNQGLAIYQKIAD 217

Query: 212 GVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVL 260
               HL  DG   +EIGY Q   V  IF+ +  F   LV+  +D  G DR++
Sbjct: 218 QAVNHLTDDGKIYLEIGYKQGKAVQAIFQEK--FTDRLVSIHQDIFGKDRMI 267


>gi|269468199|gb|EEZ79892.1| HemK family modification methylase [uncultured SUP05 cluster
           bacterium]
          Length = 262

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 116/208 (55%), Gaps = 15/208 (7%)

Query: 56  GWRDFYNVRLTLSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLA 114
           G + FY++   ++ DT  PRPETELL+D AL  F+    +K +   +LDLGTG+G + + 
Sbjct: 64  GKKGFYHLDFKVTPDTLIPRPETELLIDIALDLFN----DKEEPCHLLDLGTGSGIIAIT 119

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPP 173
           L  ++P +     DIS  AL++AK+N      + +    Q  WF +V    FD+I+SNPP
Sbjct: 120 LADKNPHWTVSATDISQAALDVAKTN-----TTAQVSFFQGSWFEAVPSQTFDLIISNPP 174

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YIE    D   L+   F+P+ +L  G DGL+  R I      HLNK G   +E G++Q+ 
Sbjct: 175 YIEQ---DDPYLDDLLFEPQTALVSGEDGLNDIRIIISDAPEHLNKGGYLLLEYGFDQQE 231

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            +V +  + K   +  FKDY  NDR +L
Sbjct: 232 RIVDLL-NEKFHHIKTFKDYNNNDRAVL 258


>gi|108804487|ref|YP_644424.1| HemK family modification methylase [Rubrobacter xylanophilus DSM
           9941]
 gi|108765730|gb|ABG04612.1| modification methylase, HemK family [Rubrobacter xylanophilus DSM
           9941]
          Length = 280

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 127/224 (56%), Gaps = 10/224 (4%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R LK E + RILG+  F N++L L+ DT  PRP+TE +V++AL     RI+ R + R+
Sbjct: 58  ISRRLKREPVQRILGYAYFRNLKLYLNEDTLIPRPDTESVVEAALE----RIDARPL-RV 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+GTG+GA+ +A+ +E P  +    DIS +ALEIA+ NA  NG   RF    +D  S +
Sbjct: 113 LDIGTGSGAIAIAIAQERPGCEVHATDISRRALEIARRNADLNGARVRFHL--ADLVSGL 170

Query: 162 E--GLFDVIVSNPPYIESVIVD-CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
              G  D++VSNPPY++       L  EVR++DP I+L  G D  + +R I +     L 
Sbjct: 171 RLPGGVDLLVSNPPYVDVRGAQRRLAPEVREWDPPIALYSGEDEYAFFRRIFEETPEVLK 230

Query: 219 KDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLF 262
           ++    +E+G  Q   V+ + E R    +   +D  G+ R +L 
Sbjct: 231 EEADVVLEVGDGQSQKVLEMGEERGFRPLGTRRDLAGDVRAVLL 274


>gi|206603662|gb|EDZ40142.1| Modification methylase (HemK) [Leptospirillum sp. Group II '5-way
           CG']
          Length = 293

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 126/241 (52%), Gaps = 15/241 (6%)

Query: 29  VLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF 88
           VL D       + + R  + E  H I G   F   R  ++  T  PRPETE+LV++ L  
Sbjct: 58  VLPDELSACYASWVERRCQREPFHLITGSVPFLEDRYAVAPGTLVPRPETEILVENVLRV 117

Query: 89  SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE 148
               ++ R   RILDLG G+G + ++LLKE P  + + VD S   LE+++ NA+ +GV  
Sbjct: 118 ----LDSRSPQRILDLGCGSGVLGISLLKEFPKARCLAVDRSVMPLEVSRKNALFHGVQS 173

Query: 149 RFDTLQSDWFS--SVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHY 206
           R   +  DW     ++  FD+IVSNPPYI S  + CL  E+  ++PR +LDGG DGL  Y
Sbjct: 174 RIHFIHGDWTEMLRLDQRFDLIVSNPPYIASGDIACLDPEILFYEPREALDGGPDGLVFY 233

Query: 207 RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNA-----FKDYGGNDRVLL 261
           R +   +   L+  G+ +VEIG  Q       F S +  +        F D  G DR++L
Sbjct: 234 RRLMAVLPGLLSSGGVAAVEIGSCQG----DFFRSEEGIVSGCGGPLVFPDILGLDRIVL 289

Query: 262 F 262
           +
Sbjct: 290 W 290


>gi|289577388|ref|YP_003476015.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter italicus Ab9]
 gi|289527101|gb|ADD01453.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter italicus Ab9]
          Length = 279

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 120/216 (55%), Gaps = 9/216 (4%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H     I+  + F  +   +  +   PRPETE+LV+ AL     R+++ DVV  LD+GTG
Sbjct: 66  HIPYQYIVKKQCFMGLEFFVDENVLIPRPETEILVEEALK----RLKRGDVV--LDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LF 165
           +GA+ +++ K  P      VDIS KA+EIAK NA   GV +R   ++SD F ++     F
Sbjct: 120 SGAIAVSIAKYFPDCTVYAVDISKKAIEIAKHNAEKQGVLDRIFFIESDLFCNLPPNLKF 179

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D IVSNPPYI+   ++ L  EV+  +P ++LDGG DGL  Y+ I      ++   G    
Sbjct: 180 DFIVSNPPYIKKREIELLQEEVKK-EPIVALDGGEDGLFFYKKIIREAPFYIKSGGKIGF 238

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           EIGY+QK +V  + E      V   KD  G DRV++
Sbjct: 239 EIGYSQKEEVTTLLEESGFKDVEIIKDLAGIDRVII 274


>gi|271500558|ref|YP_003333583.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dickeya dadantii Ech586]
 gi|270344113|gb|ACZ76878.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dickeya dadantii Ech586]
          Length = 282

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 135/259 (52%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT      ++   ++ L D +   L + + R +  E I  ++G+R+F+++ 
Sbjct: 22  RDAEILLEHVTDKRRTFLLAFGETELTDDEVLALESLLARRVNGEPIAYLVGYREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP         +LDLGTGTGA+ LA+  E P  + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQALAV-LP----DGASSVLDLGTGTGAIALAIAHERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDC 182
           VG+D    A+ +A  NA   G+ + RF  L  DWFS + G  F VIVSNPPYI+      
Sbjct: 137 VGIDRQPDAVALASQNARRLGIHNARF--LPGDWFSPLAGQRFAVIVSNPPYIDEHDPHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +VR F+P  +L  G  GL+  + I       L  DG   +E G+ Q   V  +   +
Sbjct: 195 LRGDVR-FEPASALVAGAQGLADLQHIIRQAGDFLLDDGWLLLEHGWQQGEAVRGLLSQQ 253

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               V  ++DYG N+RV L
Sbjct: 254 GFVQVKTYRDYGDNERVTL 272


>gi|257452576|ref|ZP_05617875.1| methyltransferase [Fusobacterium sp. 3_1_5R]
 gi|317059116|ref|ZP_07923601.1| methyltransferase [Fusobacterium sp. 3_1_5R]
 gi|313684792|gb|EFS21627.1| methyltransferase [Fusobacterium sp. 3_1_5R]
          Length = 368

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 7/209 (3%)

Query: 54  ILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCL 113
           ++ W +FY            PR +TE+LV+ A   SL    +++  +ILD+GTGTGA+ +
Sbjct: 159 LVKW-EFYGYEFITDERALIPRADTEILVEQAKILSL----EKENPKILDIGTGTGAIAI 213

Query: 114 ALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNP 172
            L KE P  + +G+DIS +AL +AK N     V      LQS+ F  +EG  FD+IVSNP
Sbjct: 214 TLAKEVPEAEVLGIDISERALSLAKENKEYQFVR-NVSFLQSNLFEKLEGKSFDIIVSNP 272

Query: 173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQK 232
           PYI     + L  EV++++P+ +L    DG S Y+ I    + +LN+ G    E+GY Q 
Sbjct: 273 PYIPQEEYEDLMPEVKNYEPKNALTDAGDGYSFYQRIIQEANDYLNEKGYLLFEVGYQQA 332

Query: 233 VDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             V +  E  K   +   +DY G+ RV+L
Sbjct: 333 KQVKQWMEEEKFEDLYIAEDYAGHQRVVL 361


>gi|167766741|ref|ZP_02438794.1| hypothetical protein CLOSS21_01247 [Clostridium sp. SS2/1]
 gi|167711495|gb|EDS22074.1| hypothetical protein CLOSS21_01247 [Clostridium sp. SS2/1]
          Length = 283

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 129/241 (53%), Gaps = 10/241 (4%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D + D          I +  +H  +  ILG ++F      ++ D   PR +TE +++  L
Sbjct: 47  DEINDKEAEERYKELIQKRKEHVPLQYILGTQEFMGYTFKVTPDVLIPRADTETVLEEVL 106

Query: 87  AFSLPRIEKRDVVRILDLGTGTG--AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
              +P+  K   ++ILDL TG+G  A+ LAL+ +      VG DIS KAL+IAK+N    
Sbjct: 107 -LKVPQTLKN--LKILDLCTGSGCIAISLALILKPEVC--VGTDISEKALKIAKANGENL 161

Query: 145 GVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
               +F  +QSD F +V G +D+I+SNPPYI +     L  EV+D++P ++LDG  DGL 
Sbjct: 162 APMVKF--IQSDLFENVTGSYDLIISNPPYITTEECGKLMPEVKDYEPMLALDGKEDGLY 219

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL-FC 263
            Y+ I      +LN  G+ + EIGY+Q   V  + E++    V   KD  G DR++  F 
Sbjct: 220 FYKKIIKEAKNYLNPQGMLAFEIGYDQGEAVKNLMEAQDFACVEIKKDLAGLDRLVFGFA 279

Query: 264 R 264
           R
Sbjct: 280 R 280


>gi|14517939|gb|AAK64442.1|AF377339_3 protoporphyrinogen oxidase HemK [Myxococcus xanthus]
          Length = 293

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/253 (34%), Positives = 126/253 (49%), Gaps = 9/253 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V  LS  ++ VD D  L   +       I R +  E    + G R+FYN    + +
Sbjct: 34  LLSHVLKLSRVRLYVDLDRPLSKDELGAYRALIERRMAGEPTQYLTGVREFYNRPFKVDA 93

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVV-RILDLGTGTGAVCLALLKESPFFKGVGVD 128
               PRPETELLV++AL     R+  +D   R LDL TG+G + ++L  E P    +  D
Sbjct: 94  RVLIPRPETELLVEAAL-----RMLPKDAPGRALDLCTGSGCIAISLAAERPQATVIATD 148

Query: 129 ISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLE 186
           +S  A  +A+ NA   GV++R   LQ D F+ V     F V+VSNPPYI S  +  L  E
Sbjct: 149 LSPDACALARENAQALGVADRVTVLQGDLFTPVPAGERFQVVVSNPPYIASGEIPGLSAE 208

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           VR  +P ++LDGG DGL   R +  G  + L   GL ++EIG +Q   V+ +  +     
Sbjct: 209 VRR-EPTLALDGGPDGLVAVRRVVTGARQWLEPGGLLALEIGEDQGPAVLELLRAAGYAD 267

Query: 247 VNAFKDYGGNDRV 259
               KD    +R+
Sbjct: 268 ARVEKDLERRERM 280


>gi|313899751|ref|ZP_07833254.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium sp. HGF2]
 gi|312955366|gb|EFR37031.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium sp. HGF2]
          Length = 286

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 132/258 (51%), Gaps = 12/258 (4%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
           ++  +T   +H + ++ D  +           I R L    +  +LG+  FY  R T++ 
Sbjct: 28  YMLELTNKEAHNLYMEFDEEMQPELEELYEEGIQRLLTGIPLGHVLGFEWFYGYRFTVNE 87

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRPETE LV + LA        +D V  +D+GTG+GA+ ++L KE P    +  DI
Sbjct: 88  DVLIPRPETEELVANILAAYDEHFSSQDNVMAVDIGTGSGAIAVSLKKEEPNLHMMATDI 147

Query: 130 SCKALEIAKSNAVTNGVSERF---DTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLE 186
           S +A+ +AK NA  N     F   D LQ     +++   D+++SNPPYI     + +   
Sbjct: 148 SEQAVAVAKKNADDNEAIVNFMVGDMLQPLIDRNLK--VDILISNPPYIPR--EEEMEHS 203

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           V D++P ++L GG DGL  YR I +  ++ L +  + + E+GYNQK  +    E++K F 
Sbjct: 204 VVDYEPHVALFGGEDGLKFYRIIFENAAKVLKERAMMAFEMGYNQKEALSE--EAKKYFP 261

Query: 247 ---VNAFKDYGGNDRVLL 261
              +   KD  G +R+L 
Sbjct: 262 NARIEVLKDMSGKNRMLF 279


>gi|51596332|ref|YP_070523.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pseudotuberculosis IP 32953]
 gi|170024409|ref|YP_001720914.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pseudotuberculosis YPIII]
 gi|186895375|ref|YP_001872487.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pseudotuberculosis PB1/+]
 gi|51589614|emb|CAH21244.1| putative protoporphyrinogen oxidase [Yersinia pseudotuberculosis IP
           32953]
 gi|169750943|gb|ACA68461.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Yersinia pseudotuberculosis YPIII]
 gi|186698401|gb|ACC89030.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Yersinia pseudotuberculosis PB1/+]
          Length = 276

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 131/257 (50%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ +   Q  +L     R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLSFVTGKARTYLLAFGETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E      
Sbjct: 82  LSVSSATLIPRPDTECLVEQALA-RLPSMP----CRILDLGTGTGAIALALASERRDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           + VDI+  A+ +A+ NA    + +    LQ  WF  V G F +I SNPPYI++       
Sbjct: 137 IAVDINADAVALARHNAKKLAI-DNVCFLQGSWFEPVSGRFALIASNPPYIDANDPHLNE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P  +L    +G++    I      +L   G   +E G+ Q   V    ++   
Sbjct: 196 GDVR-YEPHSALVAAAEGMADLAAIVSQAPGYLEPGGWLMLEHGWQQANAVQERLKNSGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   KDYG NDRV L
Sbjct: 255 SAVMTCKDYGNNDRVTL 271


>gi|322832985|ref|YP_004213012.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rahnella sp. Y9602]
 gi|321168186|gb|ADW73885.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rahnella sp. Y9602]
          Length = 289

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 133/259 (51%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   +++L   Q   L   + R  + E +  + G R+F+++ 
Sbjct: 22  RDAEILLGFVTGRARTFIMAFGETLLTAGQLQQLEILLARREQGEPVAYLTGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++S  T  PRP+TE LV+ AL   LP       V ILDLGTGTGA+ LAL  E P  K 
Sbjct: 82  LSVSPATLIPRPDTECLVEQAL-IRLPS----QPVSILDLGTGTGAIALALASERPDCKV 136

Query: 125 VGVDISCKALEIAKSNAVT-NGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
            GVD+   A+ +A+ NA   N ++ RF  L   WFS V G  F +I SNPPYI++     
Sbjct: 137 TGVDLQPDAVRLAQHNAQKLNILNARF--LPGSWFSPVAGERFALIASNPPYIDAADPHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L     GL+    I      +L+K G   +E G+ Q  DV  +    
Sbjct: 195 AKGDVR-FEPASALVAENAGLADLAHIIQAAPAYLHKGGWLLLEHGWQQATDVQALLRDA 253

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   KDYG NDRV L
Sbjct: 254 GYQHIATVKDYGDNDRVSL 272


>gi|110833385|ref|YP_692244.1| methyltransferase [Alcanivorax borkumensis SK2]
 gi|110646496|emb|CAL15972.1| methyltransferase [Alcanivorax borkumensis SK2]
          Length = 280

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 136/260 (52%), Gaps = 10/260 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  D+   LC V   S   +   P+  L   Q+      + R  + E +  ++G R+F+ 
Sbjct: 20  AALDAQVLLCHVLEQSRTWLFTWPERELTRAQQAEFEALLARREQGEPVAHLIGEREFFG 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
            R ++++DT  PRP+TE LV+  LA +LP        R++DLGTGTGA+ + L  E P +
Sbjct: 80  RRFSVTADTLIPRPDTETLVEQVLALALPA-----NARVVDLGTGTGAIGITLALEQPAW 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +   VD S  AL++A +NA   G + R   LQ  W +  +G FD++VSNPPYIE   V  
Sbjct: 135 QVTLVDNSAAALQVAAANARQLGATVR--CLQGSWLTPCDGFFDLVVSNPPYIEDGDVHL 192

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+PR +L  G  GL+   TIA   +  L   G   +E G+ Q  D VR   + 
Sbjct: 193 AQGDVR-FEPRSALVAGDQGLADLITIAQQAAGKLVAGGWLLLEHGFEQG-DAVRALLAD 250

Query: 243 KLFL-VNAFKDYGGNDRVLL 261
             F  V   +D GGNDRV L
Sbjct: 251 IGFEDVRTEQDLGGNDRVTL 270


>gi|327481906|gb|AEA85216.1| methyl transferase [Pseudomonas stutzeri DSM 4166]
          Length = 275

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 135/258 (52%), Gaps = 10/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPD-SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           D+   L    G S+  +   P+  V  D    F  + + R  + E +  ILG + F+++ 
Sbjct: 22  DAEWLLAAALGKSTSYLRTWPEREVPGDLAERFAAD-LARRRRGEPVAYILGRQGFWSLE 80

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP+TELLV++AL   LP        R+LDLGTGTGA+ LAL  E P ++ 
Sbjct: 81  LEVAPDTLIPRPDTELLVETALQL-LPATP----ARVLDLGTGTGAIALALAAERPQWQV 135

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
            GVD    A+ +A+ N +  G+       +SDWF+ V G  F +IVSNPPYI +      
Sbjct: 136 SGVDRIEAAVVLAERNRLRLGLGNAHFA-RSDWFAEVTGERFQLIVSNPPYIPASDPHLQ 194

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L  G+DGL   RTI      HL   G   +E G++Q   V  +  +  
Sbjct: 195 QGDVR-FEPQSALVAGVDGLDDIRTIIAQAPAHLTAGGWLLLEHGFDQAPAVRSLMAAHG 253

Query: 244 LFLVNAFKDYGGNDRVLL 261
                + +D GG++RV L
Sbjct: 254 FEACESRRDLGGHERVSL 271


>gi|27363733|ref|NP_759261.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio vulnificus CMCP6]
 gi|320157138|ref|YP_004189517.1| methylase of polypeptide chain release factors [Vibrio vulnificus
           MO6-24/O]
 gi|27359849|gb|AAO08788.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio vulnificus CMCP6]
 gi|319932450|gb|ADV87314.1| methylase of polypeptide chain release factors [Vibrio vulnificus
           MO6-24/O]
          Length = 291

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 131/258 (50%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       +   PD +L ++++      + R L  E +  I+G R+F+++  
Sbjct: 29  DAAVLLCHVLDKPRSYLFTWPDKILTEQEQQQFEALVARRLSGEPVAYIIGEREFWSLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ +AL  E P    +
Sbjct: 89  KVAPSTLIPRPDTERLVELALEKT-----ATQTGSILDLGTGTGAIAIALASELPHRTVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVDCL 183
           GVD+  +A  +A+SNA+   + +     Q  WF  V +G  F +IVSNPPYI+       
Sbjct: 144 GVDLQQEAKLLAESNALALNI-KNVTFKQGSWFEPVAQGTKFALIVSNPPYIDENDPHLN 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L     GL+  R IA     +L   G    E GY+Q + V  I ++  
Sbjct: 203 QGDVR-FEPKSALVAEESGLADIRYIAQQARDYLEPHGWLMFEHGYDQGIAVREILDTLG 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   KDYGGNDRV L
Sbjct: 262 YQEVATEKDYGGNDRVTL 279


>gi|281200544|gb|EFA74762.1| hypothetical protein PPL_11794 [Polysphondylium pallidum PN500]
          Length = 437

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 130/257 (50%), Gaps = 20/257 (7%)

Query: 24  VDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVD 83
           + P   L D Q    +  I R  K E I  I+G+R F+  +      T  PRP++E L+D
Sbjct: 178 IPPTLNLTDSQYQQFSELISRRFKDEPIAYIVGYRYFWKHQFRCDRSTLIPRPDSETLID 237

Query: 84  SALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVT 143
             +   L   E      ILDLGTGTG + L+LL E P   GVGVD S  ALEIAK N+++
Sbjct: 238 QIVM--LREYENFSPTNILDLGTGTGCLLLSLLNEFPNATGVGVDQSLDALEIAKYNSIS 295

Query: 144 -------------NGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEVR 188
                        N ++ R + +QS+W SS+     + +I+SNPPYI       L   V+
Sbjct: 296 IDKQNSSDNNSSNNIINNRVEFIQSNWLSSLSNNKKYQLIISNPPYISHSDYINLNPTVK 355

Query: 189 DFDPRISLDGGIDGLSHYRTIADGVSRH--LNKD-GLCSVEIGYNQKVDVVRIFESRKLF 245
            F+P+ +L    +GL  Y  IA  +     L++D GL   EIG NQ+ D+++I ES    
Sbjct: 356 LFEPKTALVADNNGLKDYEIIAKSIVDKDILDRDNGLVVFEIGMNQENDIIKIMESNGFE 415

Query: 246 LVNAFKDYGGNDRVLLF 262
           L    KD G   R L+F
Sbjct: 416 LKCQGKDLGRIIRCLVF 432


>gi|302879737|ref|YP_003848301.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gallionella capsiferriformans ES-2]
 gi|302582526|gb|ADL56537.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gallionella capsiferriformans ES-2]
          Length = 288

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 130/251 (51%), Gaps = 9/251 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V G++   ++  P+ +L  R+         R L  E I  +LG R+F+ +   ++ 
Sbjct: 41  LLQSVLGVNRAYLLTHPERILTVRETARYVELFARRLAGEPIAYLLGEREFFGLNFKVTP 100

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
            T  PRP+TELLV+ AL   +P         +LD+GTG+GA+ L++ +E P  + V VD 
Sbjct: 101 ATLIPRPDTELLVEMALQH-IPAGGA-----VLDMGTGSGAIALSIARERPDARVVAVDA 154

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVR 188
           S  AL +A  NA    +  R   L+SDWFS++ G  FD+I SNPPYIE+  V     +VR
Sbjct: 155 SEAALIVAAENAQRLNLG-RVRLLRSDWFSALSGERFDLIASNPPYIENGDVHLSLGDVR 213

Query: 189 DFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVN 248
            F+P  +L  G DGL   R I      +LN  G    E GYNQ   V  + +    F V+
Sbjct: 214 -FEPLSALASGADGLDDIRRIIVEAKAYLNAGGWLMFEHGYNQAERVRGLLQDAGFFGVS 272

Query: 249 AFKDYGGNDRV 259
           +  D  G +RV
Sbjct: 273 SVLDLSGIERV 283


>gi|327474248|gb|EGF19655.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK408]
          Length = 276

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 124/235 (52%), Gaps = 16/235 (6%)

Query: 30  LDDRQRFFLTNAIVRSL-KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF 88
           L+DR++     AI   L  H+    I+G  DF+ + L +      PRPETE LV+  L+ 
Sbjct: 49  LEDREQL---KAIQEQLLAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSE 105

Query: 89  SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE 148
           +     +   + ILD+GTG+GA+ L L    P ++    D+S  AL +A  NA + G+S 
Sbjct: 106 N-----RESSLSILDIGTGSGAIALTLANSRPDWQITASDLSGDALSLATENAQSCGLSL 160

Query: 149 RFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRT 208
            F  +QSD F ++ G FD+IVSNPPYI     D +GL V   +P ++L    DG + YR 
Sbjct: 161 TF--IQSDCFEAISGNFDIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYAVYRK 218

Query: 209 IADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVL 260
           IA+    HL K G   +EIGY Q   V  +   +K F    +   KD  G DR++
Sbjct: 219 IAEQAGDHLTKKGKIYLEIGYKQGDGVRELL--KKSFPQKRIRVLKDQFGKDRMV 271


>gi|325660745|ref|ZP_08149373.1| hypothetical protein HMPREF0490_00105 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472819|gb|EGC76029.1| hypothetical protein HMPREF0490_00105 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 277

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 121/226 (53%), Gaps = 10/226 (4%)

Query: 35  RFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIE 94
           R+F  + I R  +   +  I G ++F  +   ++     PR +TE+LV+ AL+  L   E
Sbjct: 56  RYF--DCISRRAQRIPLQHITGEQEFMGLPFIVNEHVLIPRQDTEILVEEALS-HLSGNE 112

Query: 95  KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQ 154
           +     +LD+ TG+G + ++L       + VG DIS +AL++AK NA +      F  L+
Sbjct: 113 Q-----VLDMCTGSGCILISLEHYRKGIRAVGADISDEALQVAKRNAESLNADVTF--LK 165

Query: 155 SDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVS 214
           SD F  V   +D+IVSNPPYI +  ++ L  EVR  DP I+LDG  DGL  YR I +   
Sbjct: 166 SDLFEQVAERYDLIVSNPPYIRTKAIEELEEEVRLHDPMIALDGKEDGLYFYRKITEKSR 225

Query: 215 RHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            HL + G    EIGY+Q  DV ++ E      V   KD  G DRV+
Sbjct: 226 EHLKQGGCLLFEIGYDQGEDVAKMMEKAGFTEVTVKKDLAGLDRVV 271


>gi|256821857|ref|YP_003145820.1| HemK family modification methylase [Kangiella koreensis DSM 16069]
 gi|256795396|gb|ACV26052.1| modification methylase, HemK family [Kangiella koreensis DSM 16069]
          Length = 286

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 127/241 (52%), Gaps = 17/241 (7%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ +L + Q+    + I R  + E    I+G ++F+++ L ++ DT  PRPETE+LV+ A
Sbjct: 52  PEYLLSEDQKSCFEDFISRRRQGEPTAYIIGEQEFWSLTLNVTRDTLIPRPETEMLVEQA 111

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L     RI   +   I+DLGTG+GA+ LA+  E P      +D+S  AL++A++NA +N 
Sbjct: 112 LL----RIPSDESYSIVDLGTGSGAIALAIASERPQATVWALDMSELALKVAQANAESNQ 167

Query: 146 VSE-RFDTLQSDWFSS-VEGLFDVIVSNPPYI---ESVIVDCLGLEVRDFDPRISLDGGI 200
           +    F+  Q  W S+ + G  D+IVSNPPY+   +  + D +      ++P  +L    
Sbjct: 168 IDNVTFE--QGSWLSNWLHGKLDMIVSNPPYVAPNDPHLADLV------YEPVTALVAED 219

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            GLS  R I    + HL  DG    E GY+Q   V  I +      +   KDY G DRV 
Sbjct: 220 KGLSDIRQITQQATEHLKPDGYLLFEHGYDQGQAVREILQQTGFEQIETIKDYAGLDRVT 279

Query: 261 L 261
           L
Sbjct: 280 L 280


>gi|241761552|ref|ZP_04759639.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373860|gb|EER63393.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 295

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 146/276 (52%), Gaps = 18/276 (6%)

Query: 2   QALRDSHSFLCRVTG--------LSSHQVIVDPDSVL-----DDRQRFFLTNAIVRSLKH 48
           +ALR++   L  V+         L +H + ++ D++L     +         AI R  ++
Sbjct: 25  EALREAARDLATVSMTARLDAELLMAHSLGIERDALLLGSWGEKEAPLSFFEAIKRRKQN 84

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  ILG+RDF+ +RLT++ D   PRP++E L+++A+A+   R +      ILDLGTG+
Sbjct: 85  EPVAYILGYRDFWTLRLTVTPDVLIPRPDSETLIETAIAYF--REQAFLPENILDLGTGS 142

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVI 168
           GA+ LA L E    KG+GVD S +A++IA+ NA   G   R +   S W   ++  FD++
Sbjct: 143 GALLLAALDEWKDAKGLGVDASTEAIKIARLNADKCGALPRVEFKISHWGRGIQQKFDLL 202

Query: 169 VSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG 228
           + NPPYI    +  +  +V  ++P ++L  G +GL  YR I   +   L + G+  +EIG
Sbjct: 203 LCNPPYIARDAM--MPADVLHYEPHLALFSGDEGLDDYREIIPEIPSLLTERGIACLEIG 260

Query: 229 YNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
           ++Q  +V  I +   L     F D     R +L  R
Sbjct: 261 FDQAENVSMIAKETGL-RSRIFYDLEQRPRCVLLSR 295


>gi|37679116|ref|NP_933725.1| methylase of polypeptide chain release factor [Vibrio vulnificus
           YJ016]
 gi|37197858|dbj|BAC93696.1| methylase of polypeptide chain release factor [Vibrio vulnificus
           YJ016]
          Length = 291

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 131/258 (50%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       +   PD +L ++++      + R L  E +  I+G R+F+++  
Sbjct: 29  DAAVLLCHVLDKPRSYLFTWPDKILTEQEQQQFEALVARRLSGEPVAYIIGEREFWSLPF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ +AL  E P    +
Sbjct: 89  KVAPSTLIPRPDTERLVELALEKT-----ATQTGSILDLGTGTGAIAIALASELPHRTVM 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS-VEGL-FDVIVSNPPYIESVIVDCL 183
           GVD+  +A  +A+SNA+   + +     Q  WF   V+G  F +IVSNPPYI+       
Sbjct: 144 GVDLQQEAKLLAESNALALNI-KNVTFKQGSWFEPVVQGTKFALIVSNPPYIDENDPHLN 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L     GL+  R IA     +L   G    E GY+Q + V  I ++  
Sbjct: 203 QGDVR-FEPKSALVAEESGLADIRYIAQQARDYLEPHGWLMFEHGYDQGIAVREILDTLG 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   KDYGGNDRV L
Sbjct: 262 YQEVATEKDYGGNDRVTL 279


>gi|331085531|ref|ZP_08334615.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330407418|gb|EGG86920.1| protein-(glutamine-N5) methyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 277

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 121/226 (53%), Gaps = 10/226 (4%)

Query: 35  RFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIE 94
           R+F  + I R  +   +  I G ++F  +   ++     PR +TE+LV+ AL+  L   E
Sbjct: 56  RYF--DCISRRAQRIPLQHITGEQEFMGLPFIVNEHVLIPRQDTEILVEEALS-HLSGNE 112

Query: 95  KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQ 154
           +     +LD+ TG+G + ++L       + VG DIS +AL++AK NA +      F  L+
Sbjct: 113 Q-----VLDMCTGSGCILISLEHYRKGIRAVGADISDEALQVAKRNAESLNADVTF--LK 165

Query: 155 SDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVS 214
           SD F  V   +D+IVSNPPYI +  ++ L  EVR  DP I+LDG  DGL  YR I +   
Sbjct: 166 SDLFEQVAERYDLIVSNPPYIRTKTIEELEEEVRLHDPMIALDGKEDGLYFYRKITEKSR 225

Query: 215 RHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            HL + G    EIGY+Q  DV ++ E      V   KD  G DRV+
Sbjct: 226 EHLKQGGWLLFEIGYDQGEDVAKMMEKAGFTEVTVKKDLAGLDRVV 271


>gi|209965908|ref|YP_002298823.1| modification methylase,hemK family [Rhodospirillum centenum SW]
 gi|209959374|gb|ACJ00011.1| modification methylase,hemK family [Rhodospirillum centenum SW]
          Length = 292

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (55%), Gaps = 5/215 (2%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E + R+LG  +F+ + LTL+ DT  PRP+TE +V++ L     R ++   +R+LDLGTG+
Sbjct: 69  EPLQRLLGSWEFWGLDLTLAPDTLIPRPDTETVVEAVLRR---RPDRTAPLRLLDLGTGS 125

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFD 166
           GA+ LALL E P   G+GVD+S  A   A  NA   G+S R   L   W +++     FD
Sbjct: 126 GAILLALLSEYPRATGLGVDLSPAAAATAALNARRLGLSGRARFLAGSWAAALGEAARFD 185

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           V+V NPPYI    +D L  EV   +PR +L GG DGL  YR IA  + R L   GL  +E
Sbjct: 186 VVVGNPPYIPDDEIDGLEPEVARHEPRRALAGGADGLDCYRAIAAELPRLLLPGGLAVLE 245

Query: 227 IGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            G +Q   V  + E+  L  V   +D  G DR  +
Sbjct: 246 HGADQASAVAALLEAAGLGPVGTVRDLAGRDRAAI 280


>gi|90022890|ref|YP_528717.1| protein methyltransferase hemK [Saccharophagus degradans 2-40]
 gi|89952490|gb|ABD82505.1| modification methylase, HemK family [Saccharophagus degradans 2-40]
          Length = 288

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 128/235 (54%), Gaps = 9/235 (3%)

Query: 31  DDRQRFFLTNAIVRSLKHES-IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL--A 87
           D  Q+F   N +V   +  + I  + G ++F+++ L +S  T  PR +TE+LV+ AL  A
Sbjct: 55  DQLQQF---NQLVSQRQQGTPIAYLTGEKEFWSLPLQVSPATLIPRGDTEILVEVALELA 111

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
            +L +   ++ +RILDLGTGTGA+ LAL  E P      VD   +A+E+A+ N    G  
Sbjct: 112 QTLQQKNPQEHIRILDLGTGTGAIALALASELPTANITAVDKMPQAVELAEKNRAALGF- 170

Query: 148 ERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHY 206
           +    L SDWFS++    F VIVSNPPYI+         +VR F+P  +L     GL+  
Sbjct: 171 KNVTVLHSDWFSAITLQKFHVIVSNPPYIDEQDPHLKQGDVR-FEPLTALVAPNQGLADI 229

Query: 207 RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           + IA+   +HL  +G   VE G+ Q   V  +FE      V + KD GGNDRV L
Sbjct: 230 QHIAEHAKQHLLPNGFLCVEHGWQQAEAVRGVFEKNGYVGVRSEKDNGGNDRVTL 284


>gi|254492179|ref|ZP_05105353.1| methyltransferase, HemK family [Methylophaga thiooxidans DMS010]
 gi|224462504|gb|EEF78779.1| methyltransferase, HemK family [Methylophaga thiooxydans DMS010]
          Length = 278

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 130/257 (50%), Gaps = 9/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D    LC V   +  ++ V P+  L+ +Q       + R  + E +  + G R F+++ L
Sbjct: 25  DVQILLCHVLDCTPTRLHVSPEHELEAQQWQLFNQLVERRKQGEPVAHLTGSRGFWSLDL 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            + + T  PRP+TELLV  AL+   P +       ++DLGTGTGA+ L+L  E      +
Sbjct: 85  LVDNSTLIPRPDTELLVSLALSKIKPNM------TVVDLGTGTGAIALSLAAEKADIDVI 138

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
             D S  AL++A+ NA  + + E+   +   W    +   FD++VSNPPYIE        
Sbjct: 139 ATDFSFAALQLAQKNANRHAL-EQVRFINMSWLVGFKSASFDLVVSNPPYIEMRDPHLNQ 197

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P  +L  G DGL   R I    ++ L KDG   VE GY Q   V ++F     
Sbjct: 198 GDVR-FEPLSALVSGPDGLEDIRQIVVQAAKCLKKDGWLLVEHGYQQSAAVQQLFTDAGF 256

Query: 245 FLVNAFKDYGGNDRVLL 261
             ++A +D+GG DR ++
Sbjct: 257 EHISAHQDFGGQDRAVM 273


>gi|302875889|ref|YP_003844522.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium cellulovorans 743B]
 gi|307689322|ref|ZP_07631768.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium cellulovorans 743B]
 gi|302578746|gb|ADL52758.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium cellulovorans 743B]
          Length = 283

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 129/260 (49%), Gaps = 7/260 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D+   L  +       +I++    +D        N I    +   +  ILG   F  + 
Sbjct: 24  EDALDLLSNILKKDRLYLIINGLDEVDKESEDIFFNFIEERGRKRPLQYILGNATFMELS 83

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
             +      PR +TE+LV+  L +    I+K +   I D+ TGTGA+ +A+    P    
Sbjct: 84  FKVKEGVLIPRADTEILVEEVLNY----IDKNNYKDICDVCTGTGAIGIAIGYHRPTTTI 139

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL---FDVIVSNPPYIESVIVD 181
              DIS  A EIAK N     V +  +  +SD  S  EGL   +DVIVSNPPYI + +++
Sbjct: 140 DICDISEIAEEIAKENIFKLKVEKNVEFYRSDLLSFAEGLHKKYDVIVSNPPYIRTSVIE 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  +V++++P ++LDGG DGL  YR I     + LNK GL + EIGY+Q  +V  + + 
Sbjct: 200 ALMEDVKNYEPHLALDGGEDGLIFYRKITKDSCKFLNKGGLLAFEIGYDQGEEVSELLKE 259

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V   KD G NDRV+L
Sbjct: 260 YGFIDVIVKKDLGNNDRVVL 279


>gi|259908617|ref|YP_002648973.1| Protein methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|224964239|emb|CAX55746.1| Protein methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283478590|emb|CAY74506.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Erwinia pyrifoliae DSM 12163]
          Length = 281

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 136/256 (53%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DS LD      L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRAWLIGFDDSELDAAALAQLDALLKRRTAGEPIAYLTGEREFWSLS 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L+++ DT  PRP++E+LV+ ALA  LP         ILDLGTG+GA+ LAL  E P  + 
Sbjct: 82  LSVTPDTLIPRPDSEVLVEQALAH-LPVAAG----SILDLGTGSGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +G+D    A+ +A+ NA   G++     +  DWFS++ +  F VIVSNPPYI++      
Sbjct: 137 IGIDRIPAAVALAQHNAARLGLTNA-TFMPGDWFSALKQQQFAVIVSNPPYIDATDKHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+  + IA    ++L   G   +E G+ Q   + +I     
Sbjct: 196 QGDVR-FEPASALVAGDGGLADIKIIAAQAGQYLANGGWLLLEHGWQQGAQIRQILSDHH 254

Query: 244 LFLVNAFKDYGGNDRV 259
              +   +DYGGNDRV
Sbjct: 255 FCQIATCQDYGGNDRV 270


>gi|255319518|ref|ZP_05360732.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter radioresistens SK82]
 gi|262378459|ref|ZP_06071616.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter radioresistens SH164]
 gi|255303458|gb|EET82661.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter radioresistens SK82]
 gi|262299744|gb|EEY87656.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter radioresistens SH164]
          Length = 274

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 123/241 (51%), Gaps = 17/241 (7%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D  L   Q+     A+ R    E +  ILG + F+ + L ++ DT  PRP+TE+LV++ L
Sbjct: 41  DKELTAEQQHAYLAALARLEAGEPLAYILGSQPFWTLDLKVTRDTLVPRPDTEVLVETVL 100

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
              LP     +  +++DLGTGTGA+ LAL  E P++  +  D+    L +A+ NA  +G+
Sbjct: 101 TLELP-----EETKMVDLGTGTGAIALALASEKPYWSVLATDVYMPTLTVARENADKHGL 155

Query: 147 SERFDTLQSDWFSSV----EGLFDVIVSNPPYIESVIVDCLGLEVRDF--DPRISLDGGI 200
            ++ +     WF+++    E +FD+IVSNPPYI     D     ++D   +P  +L    
Sbjct: 156 -QQVEFACGAWFAALNQLPEPMFDLIVSNPPYI-----DAEDRHMKDLATEPVRALVALK 209

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            GL+   TI +     L   G   +E GY Q   V   FE +    V   KDY GNDRV 
Sbjct: 210 QGLADLETIIEQGKSWLRPKGWIVLEHGYEQAEAVRSFFEHKGFQSVRTVKDYNGNDRVT 269

Query: 261 L 261
           L
Sbjct: 270 L 270


>gi|15616791|ref|NP_240003.1| HemK protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219681546|ref|YP_002467931.1| HemK protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
 gi|257471229|ref|ZP_05635228.1| HemK protein [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)]
 gi|11132929|sp|P57269|HEMK_BUCAI RecName: Full=Protein methyltransferase hemK homolog; AltName:
           Full=M.BusHemKP
 gi|25403559|pir||A84950 hemK protein [imported] - Buchnera sp. (strain APS)
 gi|10038854|dbj|BAB12889.1| hemK protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
 gi|219624389|gb|ACL30544.1| HemK protein [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
          Length = 277

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 136/256 (53%), Gaps = 7/256 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   L  VT  +   +I   +  L ++Q  +L + I R    E I  I+  ++F+++ L
Sbjct: 23  ESELLLSYVTKHTRSFIISSDEIQLTEKQYKYLNHLIHRRSLGEPIAYIIKEKEFWSLSL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S DT  PRP+TE+LV+ AL+    +I K +   ILDLGTG GA+ LAL   +  +  +
Sbjct: 83  CVSYDTLIPRPDTEILVERALS----KI-KSNSACILDLGTGCGAIALALASINSNWNII 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+D S  AL IA+ NA      +      SDWF +++  F++IVSNPPY+    +     
Sbjct: 138 GIDKSENALAIARINASKLNF-KNVTFFFSDWFLNIKKKFNIIVSNPPYVSKKEIKFFKK 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           ++  F+P  +L    +GLS    I      +L   G   +E G+ QKV V  +F+     
Sbjct: 197 DIF-FEPLSALISDNNGLSDIENIIKNSKHYLFYGGWLMIEHGWRQKVKVQYLFKKYNFH 255

Query: 246 LVNAFKDYGGNDRVLL 261
            + +++DYGGNDRV +
Sbjct: 256 EIESYQDYGGNDRVTI 271


>gi|88607095|ref|YP_505733.1| HemK family modification methylase [Anaplasma phagocytophilum HZ]
 gi|88598158|gb|ABD43628.1| modification methylase, HemK family [Anaplasma phagocytophilum HZ]
          Length = 282

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 116/226 (51%), Gaps = 5/226 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+      V GLS H+V+++PD V+   +       I R L    +  IL  R+F+++  
Sbjct: 28  DARLIAGHVLGLSEHEVLINPDLVVTAAKTKEFFEVIARRLAGVPVSHILRRREFWSIDF 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +  D  +PR +TE ++  A+        +   + I DLGTGT  + +ALL       GV
Sbjct: 88  AVGPDVLDPRQDTETIISEAIKLH----NRNRRITIADLGTGTACIIIALLSHYKNAVGV 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
             + S KA  IA  N   +G++ R    ++ W     G FD+IVSNPPYI+   +  L  
Sbjct: 144 AFEKSTKAYRIAHQNLQQHGMTGRVRLHRASW-EKCNGKFDLIVSNPPYIKRCKISGLQP 202

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
           EVR ++P ++LDGG+ G+  Y  I + + R L  DG   +EIG +Q
Sbjct: 203 EVRLYEPMVALDGGVRGMEKYLQIFEILRRCLKPDGKAILEIGEDQ 248


>gi|297543675|ref|YP_003675977.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296841450|gb|ADH59966.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 279

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 120/216 (55%), Gaps = 9/216 (4%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H     I+  + F  +   +  +   PRPETE+LV+     +L R+++ DVV  LD+GTG
Sbjct: 66  HIPYQYIVKKQYFMGLEFFVDENVLIPRPETEILVEE----TLKRLKRGDVV--LDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LF 165
           +GA+ +++ K  P      VDIS KA+EIAK NA   GV +R   ++SD F ++     F
Sbjct: 120 SGAIAVSIAKYFPDCTVYAVDISKKAIEIAKHNAKKQGVLDRIFFIESDLFCNLPPNLKF 179

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D IVSNPPYI+   ++ L  EV+  +P ++LDGG DGL  Y+ I      ++   G    
Sbjct: 180 DFIVSNPPYIKKREIELLQEEVKK-EPIVALDGGEDGLFFYKKIIREAPFYIKSGGKIGF 238

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           EIGY+QK +V  + E      V   KD  G DRV++
Sbjct: 239 EIGYSQKEEVTTLLEESGFKDVEIIKDLAGIDRVII 274


>gi|152980147|ref|YP_001351901.1| methylase of polypeptide chain release factors [Janthinobacterium
           sp. Marseille]
 gi|151280224|gb|ABR88634.1| methylase of polypeptide chain release factors [Janthinobacterium
           sp. Marseille]
          Length = 280

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 131/251 (52%), Gaps = 10/251 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  VT LS  Q+I   +  L   +   L+    R L  E I  + G R+F+ +   +S 
Sbjct: 31  LLGYVTRLSRVQLITQAERALTAEEAQQLSQLFARRLAGEPIAYLTGEREFFGLSFDVSP 90

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
               PRP+TELLV+ AL +  P+       R+LD+GTG+GA+ +A+    P      +D+
Sbjct: 91  AVLIPRPDTELLVELALHYLPPQ------GRVLDMGTGSGAIAVAIAHARPDAFVTALDV 144

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLGLEVR 188
           S +AL IA+ NA  N V   F  L+SDWFS+V E  FD+IVSNPPYI +        ++R
Sbjct: 145 SAEALAIAEGNARKNQVQVNF--LRSDWFSAVKEQRFDLIVSNPPYIVAGDPHLSEGDLR 202

Query: 189 DFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVN 248
            F+P  +L    +GLS  +TI    +R+L       +E GY+Q   V  +  +     V 
Sbjct: 203 -FEPVDALTDHANGLSDLQTITRDAARYLAPAAWLLMEHGYDQAAAVRDVLATHGFTEVQ 261

Query: 249 AFKDYGGNDRV 259
           +++D  G +RV
Sbjct: 262 SWRDLAGIERV 272


>gi|209694373|ref|YP_002262301.1| protein methyltransferase HemK [Aliivibrio salmonicida LFI1238]
 gi|208008324|emb|CAQ78476.1| protein methyltransferase HemK [Aliivibrio salmonicida LFI1238]
          Length = 288

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 130/258 (50%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  P+ ++ + +     + + R L  E I  I+G+R+F+++ L
Sbjct: 27  DAAVLLCHVLDKPRSYLLTWPEKLVAETEYNAFESLLSRRLSGEPIAYIIGYREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL    P  EK     +LDLGTGTGA+ LA+  E P    +
Sbjct: 87  KVSPTTLIPRPDTERLVEVALEHLSPSSEK-----VLDLGTGTGAIALAIASEMPDMCVI 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCL 183
           GVD    A+ +AK NA  N +    +  Q  WF  +  +  F +IVSNPPYI+       
Sbjct: 142 GVDYQYDAVALAKDNAKDNNILNT-EFRQGSWFDPIRMDEQFSIIVSNPPYIDGNDPHLS 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +G +    I +    HL ++G   +E G+ Q   +   FE   
Sbjct: 201 QGDVR-FEPQTALVAEKEGFADLIHIMEHSRTHLVENGWLLMEHGFEQGKQLRDYFEEYG 259

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DY GNDRV L
Sbjct: 260 FINVKTEQDYAGNDRVTL 277


>gi|260767752|ref|ZP_05876687.1| Polypeptide chain release factor methylase [Vibrio furnissii CIP
           102972]
 gi|260617261|gb|EEX42445.1| Polypeptide chain release factor methylase [Vibrio furnissii CIP
           102972]
          Length = 278

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 132/264 (50%), Gaps = 21/264 (7%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +LDD         + R L  E +  I+G R+F+++ L
Sbjct: 14  DAAVLLCHALDKPRSYLLTWPDKILDDTTHAAFDALLARRLTGEPVAYIIGEREFWSLPL 73

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK   +   ILDLGTGTGA+ LAL  E P  +
Sbjct: 74  KVSPSTLIPRPDTERLVEVAL-------EKAQTLDGDILDLGTGTGAIALALASELPQRR 126

Query: 124 GVGVDISCKALEIAKSNA----VTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIES 177
            VG+D+  +A ++A  NA    +TN        LQ  WF  +     F +IVSNPPYIE 
Sbjct: 127 VVGIDLRDEAQQLASDNANRLHLTN-----VTFLQGSWFEPLSHGTKFALIVSNPPYIEE 181

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   +VR F+P+ +L    +GL+  + I+D    +L   G  + E GY+Q   V  
Sbjct: 182 NDPHLAQGDVR-FEPKSALVAADNGLADIKYISDAGRDYLQSGGWLAFEHGYDQGASVRT 240

Query: 238 IFESRKLFLVNAFKDYGGNDRVLL 261
           I ++     V   +DY G+DRV L
Sbjct: 241 IMQALGYQHVITEQDYAGHDRVTL 264


>gi|51474015|ref|YP_067772.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia typhi str. Wilmington]
 gi|81389917|sp|Q68VR6|HEMK_RICTY RecName: Full=Bifunctional methyltransferase; Includes: RecName:
           Full=HemK protein homolog; Includes: RecName: Full=tRNA
           (guanine-N(7)-)-methyltransferase; AltName:
           Full=tRNA(m7G46)-methyltransferase
 gi|51460327|gb|AAU04290.1| bifunctional methyltransferase [Rickettsia typhi str. Wilmington]
          Length = 518

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 137/266 (51%), Gaps = 15/266 (5%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  VT      +++  +  L + +       + R L+HE I  I G ++FY+    ++ 
Sbjct: 31  LLQHVTNKPIEHLLIKLNEQLSEAEIEAFEKLLERRLEHEPIAYITGIKEFYSREFIVNK 90

Query: 70  DTFEPRPETELLVDSALAFSLPR--------IEKRDVVR------ILDLGTGTGAVCLAL 115
               PR +TE+L+D  +   + R        ++  D V+      IL+LGTG+G + ++L
Sbjct: 91  HVLIPRIDTEILIDVVIGLVVSRNDLNTCSKLKSLDSVKTIQHYNILELGTGSGCIAISL 150

Query: 116 LKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPY 174
           L E P    +  DIS  A+++AKSN + + V++R   + S+WF  + +  FD+IVSNPPY
Sbjct: 151 LCELPNTSVIATDISVDAIKVAKSNTIKHNVTDRIQIIHSNWFEKLNKQKFDLIVSNPPY 210

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I       + +E  +++P I+L    DGL  Y  IA    + L  +G   +EIG++Q   
Sbjct: 211 ISHSEKLEMAIETINYEPHIALFAEEDGLEAYSIIAKNAKQFLKPNGKIILEIGFSQAEK 270

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVL 260
           V +IF +    + + ++D   ++RV+
Sbjct: 271 VCQIFLNYGYNIDHIYQDLQSHNRVI 296


>gi|194364468|ref|YP_002027078.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Stenotrophomonas maltophilia R551-3]
 gi|194347272|gb|ACF50395.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Stenotrophomonas maltophilia R551-3]
          Length = 285

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 129/261 (49%), Gaps = 16/261 (6%)

Query: 8   HSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTL 67
           H   C  + L +H    DP   LD   +      + R +  E +  + G R F+ + L +
Sbjct: 35  HVLDCPRSWLFAH--ATDP---LDANDQAAFEALLARRVAGEPVAYLTGRRGFWTLDLEV 89

Query: 68  SSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGV 127
              T  PRPETELLV+     +L R+ +   +++ DLGTG+GA+ LAL  E P  + +  
Sbjct: 90  DPATLIPRPETELLVE----LALERLPQDRALQLADLGTGSGAIALALASERPQAQVLAT 145

Query: 128 DISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGL 185
           D S  AL +A  NA  + +   RF     DW++ ++G  FD+I SNPPYI S   D   L
Sbjct: 146 DASPGALTVAARNAARHELGNVRFAEGGHDWYAPLQGARFDLIASNPPYIAS---DDPHL 202

Query: 186 EVRD--FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
           E  D  F+P  +L  G+DGL   R I DG   HL   G   +E G++Q   +  +F++  
Sbjct: 203 EQGDLRFEPATALASGVDGLDDIRRIVDGGQAHLLPGGWLLIEHGWDQGAAIRALFDAAG 262

Query: 244 LFLVNAFKDYGGNDRVLLFCR 264
              V   +D    DR+ L  R
Sbjct: 263 FAEVQTVQDLEQRDRITLGRR 283


>gi|223932123|ref|ZP_03624127.1| modification methylase, HemK family [Streptococcus suis 89/1591]
 gi|302023744|ref|ZP_07248955.1| methyltransferase [Streptococcus suis 05HAS68]
 gi|330832777|ref|YP_004401602.1| modification methylase, HemK family [Streptococcus suis ST3]
 gi|223899104|gb|EEF65461.1| modification methylase, HemK family [Streptococcus suis 89/1591]
 gi|329307000|gb|AEB81416.1| modification methylase, HemK family [Streptococcus suis ST3]
          Length = 277

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 122/227 (53%), Gaps = 15/227 (6%)

Query: 40  NAIVRSL-KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV 98
           +AI + L +H     I+G  DF+ +   +      PRPETE LV+  L     +      
Sbjct: 56  DAIFQQLSQHRPAQYIIGKADFHGLEFAVDERVLIPRPETEELVNLIL-----QENSGAG 110

Query: 99  VRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWF 158
           +RILD+GTG+GA+ ++L K    ++ V VDIS  AL +A+ NA TN VS  F  L+SD F
Sbjct: 111 LRILDIGTGSGAIAISLAKARSDWEVVAVDISKDALAVAQENARTNQVSVHF--LESDVF 168

Query: 159 SSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
            +V G FD+IVSNPPYI     D +GL V   +P ++L    DG++ YR IA+     L 
Sbjct: 169 QAVTGQFDLIVSNPPYISPDDTDEVGLNVLASEPHLALFAEEDGMAIYRQIAEQAGAFLK 228

Query: 219 KDGLCSVEIGYNQKVDVVRI----FESRKLFLVNAFKDYGGNDRVLL 261
           + G    EIGY Q  D+  +    F  ++   +   KD  G DR ++
Sbjct: 229 EKGKLYFEIGYKQGQDLTDLLALHFPKKR---IRVLKDQFGQDRKVI 272


>gi|269102027|ref|ZP_06154724.1| Polypeptide chain release factor methylase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161925|gb|EEZ40421.1| Polypeptide chain release factor methylase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 282

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 133/260 (51%), Gaps = 9/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  P+  LD+ Q    ++ + R L  E +  I+G R+F+++ L
Sbjct: 27  DAAVLLCHALDKPRSYLLTWPEKELDESQFSLFSHCVSRRLAGEPVAYIIGVREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE LV+     +L +I  +   ++LDLGTGTGA+ LA+  E P     
Sbjct: 87  KVAPSTLIPRPDTERLVE----LALDKIPAQP-CQVLDLGTGTGAIALAIASERPDITVT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL--FDVIVSNPPYIESVIVDCL 183
           G+D+  +A ++A  N  T G +     L   W+S +  +  F VIVSNPPYI+       
Sbjct: 142 GIDLRQEAAQLATENGATLGFN-NVQFLAGSWYSPLAEIQQFAVIVSNPPYIDEQDPHLD 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L    +GL+  + IA+   +HL  +G   +E G+ Q + V  I     
Sbjct: 201 QGDVR-FEPKSALVAADNGLADIKIIAEQGRQHLQTNGWLLLEHGFEQGLAVREILTKLG 259

Query: 244 LFLVNAFKDYGGNDRVLLFC 263
              V   +DY G DRV L C
Sbjct: 260 YQAVVTEQDYAGLDRVTLGC 279


>gi|327462228|gb|EGF08555.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK1]
 gi|327489583|gb|EGF21375.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK1058]
          Length = 276

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 124/235 (52%), Gaps = 16/235 (6%)

Query: 30  LDDRQRFFLTNAIVRSL-KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF 88
           L+DR++     AI   L  H+    I+G  DF+ + L +      PRPETE LV+  L+ 
Sbjct: 49  LEDREQL---KAIQEQLLAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSE 105

Query: 89  SLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE 148
           +     +   + ILD+GTG+GA+ L L    P ++    D+S  AL +A  NA + G+S 
Sbjct: 106 N-----RESSLSILDIGTGSGAIALTLANSRPDWQITASDLSGDALSLATENAQSCGLSL 160

Query: 149 RFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRT 208
            F  +QSD F ++ G FD+IVSNPPYI     D +GL V   +P ++L    DG + YR 
Sbjct: 161 TF--IQSDCFEAISGNFDIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYAVYRK 218

Query: 209 IADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVL 260
           IA+    HL K G   +EIGY Q   V  +   +K F    +   KD  G DR++
Sbjct: 219 IAEQAGDHLTKKGKIYLEIGYKQGDGVRELL--KKSFPQKRIRVLKDRFGKDRMV 271


>gi|297539751|ref|YP_003675520.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylotenera sp. 301]
 gi|297259098|gb|ADI30943.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylotenera sp. 301]
          Length = 320

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 121/248 (48%), Gaps = 33/248 (13%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIE--------- 94
           R L  E +  ILG R+FY + L ++ DT  PRP+TE LV++ALA  +P  E         
Sbjct: 64  RRLAGEPMAYILGNREFYGLDLLVTPDTLIPRPDTETLVEAALA-KIPLSESTKNLSFRR 122

Query: 95  --------------------KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKAL 134
                               + D +++LDLGTGTGA+ LA+ K  P      VD S  AL
Sbjct: 123 KSESSGVEQHDYETLDSDFRRNDDLKVLDLGTGTGAIALAIAKNRPKASITAVDASDAAL 182

Query: 135 EIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           EIAK N+    +     TL S+WF ++    FDVIVSNPPYIE         ++R F+P 
Sbjct: 183 EIAKQNSQQLSIINVEFTL-SNWFENLSNQRFDVIVSNPPYIEEHDAHLTQGDLR-FEPL 240

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L  G+DGL   R I      +L   G   +E GYNQ   V  +     L  +   KD 
Sbjct: 241 SALASGMDGLDDIRQIIGDCLIYLKPQGWLMLEHGYNQAEQVADLMADAGLTNIETIKDL 300

Query: 254 GGNDRVLL 261
           G NDRV +
Sbjct: 301 GNNDRVTI 308


>gi|329121080|ref|ZP_08249711.1| protein-(glutamine-N5) methyltransferase [Dialister micraerophilus
           DSM 19965]
 gi|327471242|gb|EGF16696.1| protein-(glutamine-N5) methyltransferase [Dialister micraerophilus
           DSM 19965]
          Length = 288

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 124/219 (56%), Gaps = 10/219 (4%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGT 108
           S+  ++G +DF   +  ++     PRP+TE  V+  +     +I K D+ + + D+G G+
Sbjct: 75  SVATLIGEKDFMGFKFFVNDKVLIPRPDTETWVEKVI-----QIHKNDIELFVADIGCGS 129

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFD 166
           GA+  + LK     KGVG+DIS  A+EI+K N     +  R +  + D+F++++    FD
Sbjct: 130 GAIICSFLKYCKNAKGVGIDISDDAIEISKKNIKNLSLENRIELRKGDFFNALKKGEKFD 189

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
            I SNPPYI +  ++ L  EV++ +P I+LDGG DGL+ YR IA+   + LN  G  +VE
Sbjct: 190 GIFSNPPYIPTDDIEFLQKEVKN-EPLIALDGGKDGLNFYRKIAENAEKFLNSGGFLAVE 248

Query: 227 IGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVLLFCR 264
           +G +Q + V  +FES   F      KDYG  +R +   R
Sbjct: 249 VGIHQSLIVKEMFESTGYFTDFEIIKDYGNIERAVYCIR 287


>gi|307731137|ref|YP_003908361.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. CCGE1003]
 gi|307585672|gb|ADN59070.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. CCGE1003]
          Length = 289

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 136/262 (51%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           ++   L  V G    Q+I   D  L+    +R+    A  R +  E + +++G R+F+ +
Sbjct: 28  EARILLTHVLGWRQTQLITRADEALESACVERYLALQA--RRVAGEPVAQLVGVREFFGL 85

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++     PRPETELLV++ALA     +E     R+LDLGTGTGA+ +A+    P  +
Sbjct: 86  EFEVTPHVLIPRPETELLVETALAA----MENLARPRVLDLGTGTGAIAVAIAAMRPDAQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S +AL++A+ NA     ++R       +QSDW+ S+E    FDVIVSNPPYI S
Sbjct: 142 VSALDRSTEALKVAERNAARLLDAKRPGGAVTFMQSDWYGSLESTLRFDVIVSNPPYIAS 201

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R ++PR +L    DGLS  R I  G    L   G+  +E GY+Q   V  
Sbjct: 202 GDPHLTQGDLR-YEPRGALTDEADGLSAIRKIVAGAPARLAPQGVLWMEHGYDQAQAVRA 260

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  ++    V + +D  G +R+
Sbjct: 261 LLTAQGFADVRSERDLAGIERI 282


>gi|238927405|ref|ZP_04659165.1| polypeptide chain release factor methyltransferase HemK
           [Selenomonas flueggei ATCC 43531]
 gi|238884687|gb|EEQ48325.1| polypeptide chain release factor methyltransferase HemK
           [Selenomonas flueggei ATCC 43531]
          Length = 292

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 123/221 (55%), Gaps = 9/221 (4%)

Query: 47  KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL----VDSALAFSLPRIEKRDVVRIL 102
           +H  I  ILG R+F  +   ++ DT  PRP+TE+L    VD+  A +   +E+   +R  
Sbjct: 71  RHVPIAYILGRREFMGLPFRVTRDTLIPRPDTEILAQFAVDTLRARASAGMEE---LRFA 127

Query: 103 DLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE 162
           D+GTGTGA+ L++L  +   +   VDIS +A  +   NA+  G+  R + L  D    + 
Sbjct: 128 DIGTGTGAIALSVLNYTEGTRADAVDISPEAAAVTAENAMALGLMSRIEILIGDLAVPLL 187

Query: 163 GL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
           G  +D+I+SNPPYI +  VD L  EVR  +P ++LDGG DGLS YR +       L + G
Sbjct: 188 GRSYDMILSNPPYIPTAEVDTLMEEVRSHEPHLALDGGADGLSVYRQLMADAPDLLKEGG 247

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAF-KDYGGNDRVLL 261
           + +VE+G ++  DV  +  +    +  A  +D  G +RV++
Sbjct: 248 IIAVEVGIHEAADVASLMAAHPRIVRTAMRRDLAGIERVVI 288


>gi|169335809|ref|ZP_02863002.1| hypothetical protein ANASTE_02235 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258547|gb|EDS72513.1| hypothetical protein ANASTE_02235 [Anaerofustis stercorihominis DSM
           17244]
          Length = 279

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 123/239 (51%), Gaps = 5/239 (2%)

Query: 23  IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLV 82
           I D +  L D +       + +   H     I G ++F  +   +  +T  PRPETE++V
Sbjct: 42  ITDLNYELTDEEINEYEQLVNKRCAHVPFGYITGIKEFMGLDFHVDRETLIPRPETEIIV 101

Query: 83  DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
           +  +        K   + IL++G G+G + ++  K       +GVDI+ KAL IA  N  
Sbjct: 102 EYMIEHF-----KGITLDILEIGVGSGCISISTAKYLENVNILGVDINEKALSIANKNIE 156

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
            + V +R   ++SD + +VEG FDVI+SNPPYI   I++ L  +V+ ++P ++LDGG DG
Sbjct: 157 YHNVDDRVKFIRSDIYENVEGKFDVIISNPPYIRKDIIETLEDDVKKYEPILALDGGEDG 216

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           L  YR I    S++LN+ G    EIGY+Q   V  +        +    D  G DR ++
Sbjct: 217 LYFYREIIKNASKYLNESGHIIFEIGYDQGEQVKDLLIQNNFTNIEIINDLAGFDRTVV 275


>gi|315179417|gb|ADT86331.1| hemK protein [Vibrio furnissii NCTC 11218]
          Length = 278

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 132/264 (50%), Gaps = 21/264 (7%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +LDD         + R L  E +  I+G R+F+++ L
Sbjct: 14  DAAVLLCHALDKPRSYLLTWPDKLLDDTTHAAFDALLARRLTGEPVAYIIGEREFWSLPL 73

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVR--ILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       EK   +   ILDLGTGTGA+ LAL  E P  +
Sbjct: 74  KVSPSTLIPRPDTERLVEVAL-------EKAQTLTGDILDLGTGTGAIALALASELPQRR 126

Query: 124 GVGVDISCKALEIAKSNA----VTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIES 177
            VG+D+  +A ++A  NA    +TN        LQ  WF  +     F +IVSNPPYIE 
Sbjct: 127 VVGIDLRDEAQQLASDNANRLHLTN-----VTFLQGSWFEPLSHGTKFALIVSNPPYIEE 181

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   +VR F+P+ +L    +GL+  + I+D    +L   G  + E GY+Q   V  
Sbjct: 182 NDPHLAQGDVR-FEPKSALVAADNGLADIKHISDAGRDYLQSGGWLAFEHGYDQGASVRT 240

Query: 238 IFESRKLFLVNAFKDYGGNDRVLL 261
           I ++     V   +DY G+DRV L
Sbjct: 241 IMQALGYQHVITEQDYAGHDRVTL 264


>gi|167041274|gb|ABZ06030.1| putative CheR methyltransferase, SAM binding domain protein
           [uncultured marine microorganism HF4000_005D21]
 gi|167045779|gb|ABZ10425.1| putative methyltransferase small domain protein [uncultured marine
           bacterium HF4000_APKG3108]
          Length = 279

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 126/226 (55%), Gaps = 9/226 (3%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
             +AI R +  E +  I+G ++F++    ++  T  PRPETELL+   + F      K  
Sbjct: 57  FNHAIQRRINREPVAYIIGKKEFWSQDFAVNQATLVPRPETELLIYKVVDFF-----KNK 111

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV--SERFDTLQS 155
            + +LD+GTG+G + L++LKE    +GVG+DIS KA++ A+ N+    +    +F     
Sbjct: 112 RINVLDIGTGSGCILLSILKELDLSRGVGIDISTKAIKTAQINSKNLNLFHQSKFKVFDI 171

Query: 156 DWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSR 215
             F+   G +D+IVSNPPYI S  +  L  ++ +++P ++L+GG+DGL   R +    + 
Sbjct: 172 SKFNV--GKYDLIVSNPPYIPSKDIKNLSKDIINYEPLVALNGGLDGLDLIRKVIYKSNS 229

Query: 216 HLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            L K+GL ++EIG+NQ + V  +        ++   DY  N R ++
Sbjct: 230 LLKKNGLLAIEIGFNQYLKVSSLLRQYGFREMSRQCDYNHNVRCII 275


>gi|254000221|ref|YP_003052284.1| HemK family modification methylase [Methylovorus sp. SIP3-4]
 gi|253986900|gb|ACT51757.1| modification methylase, HemK family [Methylovorus sp. SIP3-4]
          Length = 297

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 116/232 (50%), Gaps = 21/232 (9%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E I  ILG R+F+ +RL +S  T  PRP+TE LV++ALA    RI   D   +LD
Sbjct: 68  RRLAGEPIAYILGNREFFGLRLAVSPATLIPRPDTETLVEAALA----RIPSEDTREVLD 123

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV----------TNGVSE-RFDT 152
           LGTGTGA+ LA+    P  + +GVD S  AL++A+ NA           T+G+++   + 
Sbjct: 124 LGTGTGAIALAIAAHRPKSRVIGVDASAAALQVARQNAEALGLAITEPDTHGITKGNVEF 183

Query: 153 LQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDF--DPRISLDGGIDGLSHYRTI 209
               WF+ + GL FDVIVSNPPYI     D   L+  D   +P  +L  G DGL   R I
Sbjct: 184 RLGSWFTPLAGLKFDVIVSNPPYIRK---DDPHLQQGDLRHEPFSALASGADGLDDIRII 240

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
                 H    G   +E GY+Q   V  +        V    D  G  RV L
Sbjct: 241 VQHAPAHFQPSGWLLLEHGYDQADAVATLMRDTGFSDVQHAHDLAGIARVTL 292


>gi|242239291|ref|YP_002987472.1| modification methylase, HemK family [Dickeya dadantii Ech703]
 gi|242131348|gb|ACS85650.1| modification methylase, HemK family [Dickeya dadantii Ech703]
          Length = 279

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 135/260 (51%), Gaps = 12/260 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     +I   +++L D Q+  L   + R    E I  + G ++F+++ 
Sbjct: 22  RDAEILLGHVTGKRRTFLIAFGETLLSDDQQQMLEGLLTRRSAGEPIAYLTGEKEFWSLA 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL    P+      + +LDLGTGTGA+ LA+  E P    
Sbjct: 82  LEVSPATLIPRPDTECLVEQALQRLPPQ-----ALSVLDLGTGTGAIALAIASERPACDV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDC 182
           +GVD    A+ +A  NA   G+   RF  L  DWFSS+ E  F +IVSNPPYI++     
Sbjct: 137 LGVDCQPDAVTLATHNARRLGIHNVRF--LLGDWFSSLNEQRFSMIVSNPPYIDAADPHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD-GLCSVEIGYNQKVDVVRIFES 241
              +VR ++P  +L  G  GL+  R I    SRH   D G   +E G+ Q   V  +F  
Sbjct: 195 NCGDVR-YEPASALVAGEHGLADLRHIVQ-YSRHFLLDGGWLLLEHGWLQGESVRELFWQ 252

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V   +DYGGN+RV L
Sbjct: 253 YGFSQVETCRDYGGNERVSL 272


>gi|119472533|ref|ZP_01614581.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Alteromonadales bacterium TW-7]
 gi|119444857|gb|EAW26157.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Alteromonadales bacterium TW-7]
          Length = 279

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 127/257 (49%), Gaps = 8/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V       +   P+ +L   Q+        R L  E +  I G R+F+++ L
Sbjct: 26  DAQVLLLHVLDKPRSYLFTWPERLLSTEQQHSFDTLCARRLSGEPVAHITGQREFWSLTL 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +++ T  PRP+TE LV++AL   +      +  ++LDLGTGTGA+ LAL  E P +   
Sbjct: 86  EVNATTLIPRPDTETLVEAALGLGI-----SENAKVLDLGTGTGAIALALGSEMPLWNIT 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLG 184
            VD    A+ +A  N    G+S      QS+WFSS++   FD+IV+NPPYIES       
Sbjct: 141 AVDKVTDAVTLATRNQQRLGLS-NVRVKQSNWFSSLDNEYFDLIVTNPPYIESSDEHLAQ 199

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P  +L     G+S  + I      +L   G   +E GY+Q   V   F++   
Sbjct: 200 GDVR-FEPLSALVAEDSGMSDIKQIITHSRDYLLSSGYLLIEHGYDQGFAVREFFKTMAF 258

Query: 245 FLVNAFKDYGGNDRVLL 261
             +   KD G NDRV L
Sbjct: 259 VNIKTIKDLGENDRVTL 275


>gi|226315062|ref|YP_002774958.1| hypothetical protein BBR47_54770 [Brevibacillus brevis NBRC 100599]
 gi|226098012|dbj|BAH46454.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 296

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 126/243 (51%), Gaps = 7/243 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           PDS+ D      L    VR   +E +  + G ++FY    T+      PRPETE+LV+  
Sbjct: 56  PDSI-DAETLVKLDGLCVRRANNEPLQYMFGEQEFYGRPFTVRPGVLIPRPETEILVEQV 114

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           +A +     + + + ++D+GTG+GA+C+ L  E P ++   VD+S +A  IA+ NA   G
Sbjct: 115 MAAATMLWPESEELAVVDIGTGSGAICITLALEKPQWRVTTVDLSLEATAIARENASRLG 174

Query: 146 VSERFDTLQSDWFSSVEGL---FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
              RF  LQ D    +       DV+VSNPPYI S  V+ L  EVR  +PR++LDGG DG
Sbjct: 175 ADVRF--LQGDLVQPLLEAGEKVDVLVSNPPYIPSRDVEELDDEVRVHEPRLALDGGEDG 232

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF-LVNAFKDYGGNDRVLL 261
           L  YR + + +   L    + + E+G  Q  DV  +  +  +   V    D  G +RV++
Sbjct: 233 LDCYRRLCEALPNLLKDRAVVAFEVGIYQARDVAALMRASGVMDEVEIVPDLAGIERVVI 292

Query: 262 FCR 264
             R
Sbjct: 293 GVR 295


>gi|328952116|ref|YP_004369450.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfobacca acetoxidans DSM 11109]
 gi|328452440|gb|AEB08269.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfobacca acetoxidans DSM 11109]
          Length = 296

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 118/215 (54%), Gaps = 2/215 (0%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D  L + +       + R L HE    I G ++F+++   ++     PRPETELLV+ A 
Sbjct: 54  DQPLGENELSCYKKLLKRRLAHEPTQYITGRQEFWSLDFLVTPAVLIPRPETELLVEVAA 113

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
           A+   +  +   VR++D+GTG+G + + L KE P  +   +D S +AL +A+ NA  +GV
Sbjct: 114 AYLQGQRAEETSVRLIDVGTGSGVLAVVLAKEHPQAQVTALDQSWEALCLARQNARRHGV 173

Query: 147 SERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
            ER   +  D  +++  E  FD+IVSN PY+ +     L  +++D++PR++LDGG DGL 
Sbjct: 174 EERIRFIMGDLLAALRPEAQFDLIVSNAPYVPTAEWLRLPSDIKDYEPRLALDGGGDGLD 233

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
             R +      +L   GL ++E+G  Q   V ++ 
Sbjct: 234 VIRRLVQAAPGYLKAGGLLALEVGQGQSAAVEQLL 268


>gi|329296265|ref|ZP_08253601.1| release factor-specific protein-(glutamine-N5) methyltransferase
           [Plautia stali symbiont]
          Length = 276

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 134/259 (51%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   +I   DS L+D Q   L   + R ++ E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRSGLIAFDDSPLNDAQLAQLETLLARRVRGEPIAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE+LV+ AL   LP         +LDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LRVSDATLIPRPDTEVLVEQAL-LRLPATPS----AVLDLGTGTGAIALALASERPDCQI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
            G D    A+ +A+ NA    ++     L S WF  +    FD+IVSNPPYI++      
Sbjct: 137 TGCDRIAAAVALAQDNAQRLHLTNAGFVL-SHWFDDLPAQRFDLIVSNPPYIDAADEHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+  R I +     L   G   +E G+ Q  + VR   +R 
Sbjct: 196 QGDVR-FEPLSALVAEEAGLADLRLIIERAPHWLQPQGWLLLEHGWQQG-EAVRTLLTRN 253

Query: 244 LFL-VNAFKDYGGNDRVLL 261
            FL V   +DYGGN RV L
Sbjct: 254 GFLAVTTVEDYGGNPRVTL 272


>gi|313202187|ref|YP_004040845.1| HemK family modification methylase [Methylovorus sp. MP688]
 gi|312441503|gb|ADQ85609.1| modification methylase, HemK family [Methylovorus sp. MP688]
          Length = 297

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 120/232 (51%), Gaps = 21/232 (9%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+F+ +RL +S  T  PRP+TE LV++ALA  +P  E R   ++LD
Sbjct: 68  RRLAGEPVAYILGNREFFGLRLAVSPATLIPRPDTETLVEAALAH-IPSEETR---QVLD 123

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER----FDTLQSD--- 156
           LGTGTGA+ LA+    P  + + VD S  AL++A+ NA   G++       DT + +   
Sbjct: 124 LGTGTGAIALAIAAHRPQSRVIAVDASAAALQVARHNAEALGLATPEAGDQDTTKGNVEF 183

Query: 157 ----WFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDF--DPRISLDGGIDGLSHYRTI 209
               WF+ + GL FDVIVSNPPYI     D   L+  D   +P  +L  G+DGL   R I
Sbjct: 184 RLGSWFTPLAGLKFDVIVSNPPYIRK---DDPHLQQGDLRHEPLSALASGVDGLDDIRII 240

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
                 HL   G   +E GY+Q   V  +  +     V    D  G  RV L
Sbjct: 241 VQHAPAHLQPSGWLLLEHGYDQADAVATLMRNTGFSDVQHAHDLAGIARVTL 292


>gi|291527967|emb|CBK93553.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Eubacterium rectale M104/1]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 116/210 (55%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  I+G ++F  ++  ++S+   PR +TE LV+ AL    P +      R+LD+ TG+G 
Sbjct: 70  LQYIVGEQEFMGLKFRVNSNVLIPRQDTETLVEEALKVIEPGM------RVLDMCTGSGC 123

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + +++LK +    G   DIS +AL +AK NA  NGV   F+  +SD F  V+ ++DVIVS
Sbjct: 124 IIISILKNTTNVDGAACDISKQALNVAKENARLNGVFVDFE--RSDLFEHVDEMYDVIVS 181

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S  +  L  EV  F+P  +LDG  DGL  YR I      +L   G    EIG +
Sbjct: 182 NPPYIRSDEIPHLMPEVSVFEPHEALDGSEDGLLFYRRIIKDCRANLKPHGRLLFEIGCD 241

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V ++ +      V+  KD  GNDRV+
Sbjct: 242 QGRQVSQMMQFAGFSDVHVIKDLAGNDRVV 271


>gi|187925495|ref|YP_001897137.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia phytofirmans PsJN]
 gi|187716689|gb|ACD17913.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia phytofirmans PsJN]
          Length = 286

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 135/262 (51%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           ++   L  V G    Q+I   D  LD +  +R+    A  R +  E + +++G R+F+ +
Sbjct: 25  EARILLTHVLGWRPTQLITRSDEALDGKLVERYQTLEA--RRVAGEPVAQLVGAREFFGL 82

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++     PRPETELLVD+AL+     +E     R+LDLGTGTGA+ +A+    P  +
Sbjct: 83  DFEVTPHVLIPRPETELLVDTALSA----LENLVRPRVLDLGTGTGAIAVAIASMRPDAR 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDT----LQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S +AL +A  NA     ++R        QSDW+ S++    FDVIVSNPPYI S
Sbjct: 139 VWALDRSAEALAVATRNAARLLDAQRPGGAVVLTQSDWYDSLDAALRFDVIVSNPPYIAS 198

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  R I  G    L  DG+  +E GY+Q   V  
Sbjct: 199 GDPHLYEGDLR-FEPRGALTDEADGLSAIRAIIAGAPTRLAADGVLWIEHGYDQAEAVRA 257

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  ++    V + +D  G +R+
Sbjct: 258 LLTAQGFAQVRSERDLAGIERI 279


>gi|156933677|ref|YP_001437593.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Cronobacter sakazakii ATCC BAA-894]
 gi|156531931|gb|ABU76757.1| hypothetical protein ESA_01499 [Cronobacter sakazakii ATCC BAA-894]
          Length = 285

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 134/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L D +   L   + R    E +  ++G R+F+++ 
Sbjct: 22  RDAEILLAFVTGRTRTFILAFGETALTDDEHERLDALLARRAAGEPVAYLIGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP         ILDLGTGTGA+ LAL  E P    
Sbjct: 82  LEVSPATLIPRPDTECLVEQALA-RLPATP----CCILDLGTGTGAIALALASERPDCHV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             +D+  +A+ +AK NA   G+ +    LQS WFS++  + F +IVSNPPYI+       
Sbjct: 137 TALDVIPEAVALAKRNAQRLGI-DNVTILQSHWFSALTDVRFSLIVSNPPYIDGDDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P+ +L     GL+   T+     R L  +G   +E G+ Q   V  +F    
Sbjct: 196 QGDVR-FEPKSALVADDAGLADLETLVTEARRFLEDNGWLMLEHGWQQGEAVRELFTRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YQAVETCRDYGGNERLTL 272


>gi|291524541|emb|CBK90128.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Eubacterium rectale DSM 17629]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 115/210 (54%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  I+G ++F  ++  ++S+   PR +TE LV+ AL    P +      R+LD+ TG+G 
Sbjct: 70  LQYIVGEQEFMGLKFRVNSNVLIPRQDTETLVEEALKVIEPGM------RVLDMCTGSGC 123

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + +++LK +    G   DIS +AL +AK NA  NGV   F+  +SD F  V+ ++DVIVS
Sbjct: 124 IIISILKNTTNVDGAACDISKQALNVAKENARLNGVFVDFE--RSDLFEHVDEMYDVIVS 181

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S  +  L  EV  F+P  +LDG  DGL  YR I      +L   G    EIG +
Sbjct: 182 NPPYIRSDEIPHLMPEVSVFEPHEALDGSEDGLLFYRRIIKDCRANLKPQGRLLFEIGCD 241

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V  + +      V+  KD  GNDRV+
Sbjct: 242 QGRQVSEMMQFAGFSDVHVIKDLAGNDRVV 271


>gi|238923859|ref|YP_002937375.1| putative rRNA or tRNA methylase [Eubacterium rectale ATCC 33656]
 gi|238875534|gb|ACR75241.1| predicted rRNA or tRNA methylase [Eubacterium rectale ATCC 33656]
          Length = 283

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 115/210 (54%), Gaps = 8/210 (3%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  I+G ++F  ++  ++S+   PR +TE LV+ AL    P +      R+LD+ TG+G 
Sbjct: 70  LQYIVGEQEFMGLKFRVNSNVLIPRQDTETLVEEALKVIEPGM------RVLDMCTGSGC 123

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170
           + +++LK +    G   DIS +AL +AK NA  NGV   F+  +SD F  V+ ++DVIVS
Sbjct: 124 IIISILKNTTNVDGAACDISKQALNVAKENARINGVFVDFE--RSDLFEHVDEMYDVIVS 181

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYN 230
           NPPYI S  +  L  EV  F+P  +LDG  DGL  YR I      +L   G    EIG +
Sbjct: 182 NPPYIRSDEIPHLMPEVSVFEPHEALDGSEDGLLFYRRIIKDCRANLKPQGRLLFEIGCD 241

Query: 231 QKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           Q   V  + +      V+  KD  GNDRV+
Sbjct: 242 QGRQVSEMMQFAGFSDVHVIKDLAGNDRVV 271


>gi|294635784|ref|ZP_06714244.1| protein-(glutamine-N5) methyltransferase [Edwardsiella tarda ATCC
           23685]
 gi|291090884|gb|EFE23445.1| protein-(glutamine-N5) methyltransferase [Edwardsiella tarda ATCC
           23685]
          Length = 278

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 137/260 (52%), Gaps = 12/260 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  V+G     ++   ++ L   Q   L   + R  + E +  ++G R+F+++ 
Sbjct: 23  RDAEILLEHVSGKGRSFILAFGETRLTAAQLERLAALLARREQGEPVAYLIGQREFWSLA 82

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL     R+  R   +I+DLGTGTGA+ LAL  E P  + 
Sbjct: 83  LEVSPATLIPRPDTECLVEQALQ----RLPARP-AQIVDLGTGTGAIALALASERPDCRV 137

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             V+ + +A+ +A+ NA   G++ R + LQ  WF+ + G  FD+IV+NPPYI++   D  
Sbjct: 138 SAVEFNPEAVALARRNAERLGLA-RVEILQGSWFAPLAGRRFDMIVANPPYIDA---DDA 193

Query: 184 GLEVRD--FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L + D  F+P  +L     GL+  R IA     +L  +G   +E G+ Q   V  +   
Sbjct: 194 HLSLGDVRFEPASALVAAEQGLADLRIIASQAPHYLAAEGWLLLEHGWQQGAAVRALLND 253

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V + +DYG N+RV L
Sbjct: 254 VGFSRVESVRDYGDNERVTL 273


>gi|227486770|ref|ZP_03917086.1| polypeptide chain release factor methyltransferase HemK
           [Anaerococcus lactolyticus ATCC 51172]
 gi|227235240|gb|EEI85255.1| polypeptide chain release factor methyltransferase HemK
           [Anaerococcus lactolyticus ATCC 51172]
          Length = 264

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 135/253 (53%), Gaps = 12/253 (4%)

Query: 11  LCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSD 70
           L  + G S   ++++ +  L+  Q   L + I +      +   +G  +FY++RL +   
Sbjct: 18  LTYILGKSKSYILMNQNLELNSEQNQRLNDIINKRKVSYPLQYAIGQWEFYDLRLKVDER 77

Query: 71  TFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLK--ESPFFKGVGVD 128
              PR ETE++VD  +   + +       +ILD+GTGTGA+ LAL K  E+ F   +G D
Sbjct: 78  ALIPRFETEIIVDYLIKSPMKK------EKILDIGTGTGAIALALAKNIENSFV--IGSD 129

Query: 129 ISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVR 188
           I  +AL +A+ N V  G ++  D ++SD F  + G +D+I+SNPPYI+    + L  E+ 
Sbjct: 130 IEDRALSLARENKVFTG-TKNVDFIKSDLFKDISGAYDLIISNPPYIDKKDYESLEKELY 188

Query: 189 DFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVN 248
            F+P+ +L GG DGL  YR I      +L + G    EIGYNQK  + ++  ++    + 
Sbjct: 189 -FEPKSALYGGEDGLDFYREIIKNAGAYLCEGGHLVFEIGYNQKDILNKLLVNQGFVNIE 247

Query: 249 AFKDYGGNDRVLL 261
             KD+   DR ++
Sbjct: 248 NIKDFNDFDRFII 260


>gi|108759552|ref|YP_633065.1| putative protein methyltransferase HemK [Myxococcus xanthus DK
           1622]
 gi|108463432|gb|ABF88617.1| putative protein methyltransferase HemK [Myxococcus xanthus DK
           1622]
          Length = 293

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 126/253 (49%), Gaps = 9/253 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V  LS  ++ VD D  L   +       I R +  E    + G R+FYN    + +
Sbjct: 34  LLSHVLKLSRVRLYVDLDRPLSKDELGAYRALIERRMAGEPTQYLTGVREFYNRPFKVDA 93

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVV-RILDLGTGTGAVCLALLKESPFFKGVGVD 128
               PRPETELLV++AL     R+  +D   R LD+ TG+G + ++L  E P    +  D
Sbjct: 94  RVLIPRPETELLVEAAL-----RMLPKDAPGRALDVCTGSGCIAISLAAERPQATVIATD 148

Query: 129 ISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLE 186
           +S  A  +A+ NA   GV++R   LQ D F+ V     F V+VSNPPYI S  +  L  E
Sbjct: 149 LSPDACALARENAQALGVADRVTVLQGDLFTPVPAGERFQVVVSNPPYIASGEIPGLSAE 208

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL 246
           VR  +P ++LDGG DGL   R +  G  + L   GL ++EIG +Q   V+ +  +     
Sbjct: 209 VRR-EPTLALDGGPDGLVAVRRVVTGARQWLEPGGLLALEIGEDQGPAVLELLRAAGYAD 267

Query: 247 VNAFKDYGGNDRV 259
               KD    +R+
Sbjct: 268 ARVEKDLERRERM 280


>gi|153948102|ref|YP_001401038.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pseudotuberculosis IP 31758]
 gi|152959597|gb|ABS47058.1| methyltransferase, HemK family [Yersinia pseudotuberculosis IP
           31758]
          Length = 276

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 130/257 (50%), Gaps = 7/257 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ +   Q  +L     R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLSFVTGKARTYLLAFGETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++SS T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E      
Sbjct: 82  LSVSSATLIPRPDTECLVEQALA-RLPSMP----CRILDLGTGTGAIALALASERRDCAV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           + VDI+  A+ +A+ NA    + +    LQ  WF  V G F +I SNPPYI++       
Sbjct: 137 IAVDINADAVALARHNAKKLAI-DNVCFLQGSWFEPVSGRFALIASNPPYIDANDPHLNE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR ++P   L    +G++    I      +L   G   +E G+ Q   V    ++   
Sbjct: 196 GDVR-YEPHSVLVAAAEGMADLAAIVSQAPGYLEPGGWLMLEHGWQQANAVQERLKNSGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   KDYG NDRV L
Sbjct: 255 SAVMTCKDYGNNDRVTL 271


>gi|313889399|ref|ZP_07823047.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122231|gb|EFR45322.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 276

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 122/215 (56%), Gaps = 12/215 (5%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG 109
           S   I G   F  + LT++     PRPETE LV+  LA +     KR  +++LD+GTG+G
Sbjct: 67  SPQYITGKAYFRELILTVNESVLIPRPETEELVELILAEN-----KRHDLQLLDIGTGSG 121

Query: 110 AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIV 169
           A+ ++L KE P +K    DIS +ALE+A+ NA+ NG    F   QSD FSS+ G FD+IV
Sbjct: 122 AIAISLKKERPSWKVTASDISLEALEVAQINALKNGTDIMFS--QSDLFSSLSGKFDIIV 179

Query: 170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY 229
           SNPPYI     + +G  V   +P ++L    +GL+ YR+I +   ++L+  G    EIGY
Sbjct: 180 SNPPYIAFADKEEVGRNVLASEPHLALFAEEEGLAIYRSILEQAEQYLSPQGKLYFEIGY 239

Query: 230 NQK---VDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            Q     D+V+     K F +   +D  G DR+++
Sbjct: 240 KQGQALFDLVKTNFPEKRFRLK--QDCYGKDRMVI 272


>gi|223935327|ref|ZP_03627245.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [bacterium Ellin514]
 gi|223896211|gb|EEF62654.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [bacterium Ellin514]
          Length = 289

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 114/217 (52%), Gaps = 6/217 (2%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAF--SLPRIEKRDVVRILDLGT 106
           E +  ILG   F  +   ++     PRPETELL +    F  SLP      V   LD GT
Sbjct: 70  EPLQHILGSTCFCGLEFEVNPKVLIPRPETELLAELGWQFLNSLPSSPTPPVA--LDYGT 127

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GL- 164
           G+G + + +  +SP  +   +DIS  AL  A+ NA T+ +  R      D F++V  GL 
Sbjct: 128 GSGCLAVTVAAKSPTAQLHALDISPDALATAQKNAATHQMGSRIQFHLGDGFAAVPPGLQ 187

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           F++I+SNPPYI S  +  L  EVRD DPR++LDGG DGL  YR +A   +  L  +G   
Sbjct: 188 FNLIISNPPYIASDEIATLQPEVRDHDPRLALDGGRDGLDFYRRLAKEAAPRLLPNGKIM 247

Query: 225 VEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           +E G  Q   + ++FE  K  +     DY G  R+L+
Sbjct: 248 LEFGEGQAEAIQKLFEDEKWVVEGVKADYSGRLRILI 284


>gi|300172697|ref|YP_003771862.1| protein methyltransferase prmC [Leuconostoc gasicomitatum LMG
           18811]
 gi|299887075|emb|CBL91043.1| Protein methyltransferase prmC [Leuconostoc gasicomitatum LMG
           18811]
          Length = 335

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 123/221 (55%), Gaps = 5/221 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + + + +E +  ILG   FY     + S    PRPETE LV+  L  +  +  K   V +
Sbjct: 113 LAKLMNNEPVQYILGHAPFYGREFMVDSRVLIPRPETEQLVEWILKDAGSKNGKP--VSV 170

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+GTGTGA+   L+ E+P  +G   DIS  AL +A+ NA   G++     +QSD +S+V
Sbjct: 171 LDIGTGTGAIIETLMLENPRVRGFAADISSGALAVAEMNAQRFGLN-YLHLVQSDVYSAV 229

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           EGL FD+IVSNPPYI +   D +   V +++P  +L    DGL+ Y  IA  ++ +L+ +
Sbjct: 230 EGLEFDIIVSNPPYIATTDEDEMADNVLEYEPHTALFADHDGLAIYEKIAADLALYLSDN 289

Query: 221 GLCSVEIGYNQKVDVVRIFE-SRKLFLVNAFKDYGGNDRVL 260
           G    EIGY Q   VV + + +     V   KD+ G DR++
Sbjct: 290 GRAYFEIGYKQGQQVVSMMQHALPQAEVTLKKDFSGLDRMV 330


>gi|241763795|ref|ZP_04761841.1| modification methylase, HemK family [Acidovorax delafieldii 2AN]
 gi|241366927|gb|EER61332.1| modification methylase, HemK family [Acidovorax delafieldii 2AN]
          Length = 284

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 120/234 (51%), Gaps = 6/234 (2%)

Query: 25  DPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDS 84
           D D++  + Q  FL     R    E +  + G ++FY + L + +   +PRP+TE LVD 
Sbjct: 47  DTDALAPEVQAQFL-GLCQRRAAGEPVAYLTGRKEFYGLPLCVDARVLDPRPDTETLVDW 105

Query: 85  ALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
           AL    P  + +   RI+DLGTG+GA+ LAL  + P  + +GVD S  AL +A++NA   
Sbjct: 106 ALEVIAPLSDPQHPPRIVDLGTGSGAIALALQHQRPTAEVLGVDASPDALAVAQANAQRL 165

Query: 145 GVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
            +  +F  +QS W + V+G+FD IVSNPPYI +       L     +P  +L  G DGL 
Sbjct: 166 VLPVQF--VQSHWLTGVDGVFDAIVSNPPYIPAHDPHLAALT---HEPLQALASGADGLQ 220

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
             R I     RHL   G   +E G++Q   V  +  ++    V +  D  G  R
Sbjct: 221 DIRQIVVQAPRHLKPGGWLLLEHGHDQAGAVSALLRAQGFAQVQSRNDLAGIAR 274


>gi|315127041|ref|YP_004069044.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas sp. SM9913]
 gi|315015555|gb|ADT68893.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Pseudoalteromonas sp. SM9913]
          Length = 279

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 126/239 (52%), Gaps = 16/239 (6%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L D Q      A  R L  E +  I G+R+F++++L ++  T  PRP+TE LV+ A
Sbjct: 46  PEKQLTDEQSQAFERACERRLNGEPVSHITGYREFWSLQLEVNPTTLIPRPDTETLVELA 105

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN----A 141
           L+ ++P     +  ++LDLGTGTGA+ LAL  E P +  + VD    A+ +AK N    A
Sbjct: 106 LSCNVP-----NDAKVLDLGTGTGAIALALGSEMPTWDIIAVDRIDDAVALAKRNQKRLA 160

Query: 142 VTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGI 200
           + N   E     QS+WFS++    FD+IV+NPPYIE         +VR F+P  +L    
Sbjct: 161 INNVCVE-----QSNWFSALNNKKFDLIVTNPPYIEYNDKHLHQGDVR-FEPLSALVADD 214

Query: 201 DGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            GL+  + I      +L+ +G   +E G+ Q   V  IF       V+  KD G NDRV
Sbjct: 215 AGLADIKQIITQSRDYLHSNGYLLIEHGFEQSAAVRHIFNQMAFINVSTVKDLGNNDRV 273


>gi|313891849|ref|ZP_07825454.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dialister microaerophilus UPII 345-E]
 gi|313119843|gb|EFR43030.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dialister microaerophilus UPII 345-E]
          Length = 288

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 123/219 (56%), Gaps = 10/219 (4%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGT 108
           S+  ++G +DF   +  ++     PRP+TE  V+  +     +I K D+ + + D+G G+
Sbjct: 75  SVATLIGEKDFMGFKFFVNDKVLIPRPDTETWVEKVI-----QIHKNDIELFVADIGCGS 129

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFD 166
           GA+  + LK     KGVG+DIS  A+EI+K N     +  R +  + D+F++++    FD
Sbjct: 130 GAIICSFLKYCKNAKGVGIDISDDAIEISKKNIKNLSLENRIELRKGDFFNALKKGEKFD 189

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
            I SNPPYI +  +  L  EV++ +P I+LDGG DGL+ YR IA+   + LN  G  +VE
Sbjct: 190 GIFSNPPYIPTDDIKFLQKEVKN-EPLIALDGGKDGLNFYRKIAENAEKFLNSGGFLAVE 248

Query: 227 IGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVLLFCR 264
           +G +Q + V  +FES   F      KDYG  +R +   R
Sbjct: 249 VGIHQSLIVKEMFESTGYFTDFEIIKDYGNIERAVYCIR 287


>gi|295095635|emb|CBK84725.1| [protein release factor]-glutamine N5-methyltransferase
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 276

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 133/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q+  L   + R    E +  ++  R+F+++ 
Sbjct: 22  RDAEILLEHVTGKARTYLLAFGETALTAEQQSQLEALLARRKTGEPVAHLVCEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S+ T  PRP+TE LV+ ALA  LP        +ILDLGTGTGA+ LAL  E P    
Sbjct: 82  LYVSAATLIPRPDTECLVEQALA-RLP----AQPCQILDLGTGTGAIALALASERPDCTV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A+ N    G++     LQS WF+++E  +F++IVSNPPYI+       
Sbjct: 137 TAVDVMPDAVALARRNVERLGLN-NVSVLQSSWFAALESRMFEMIVSNPPYIDEDDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+    I     +HL   G   VE G+ Q   V  +F    
Sbjct: 196 QGDVR-FEPLTALVAANQGLADLDHIVTTSRQHLLPGGWLLVEHGWTQGEAVRALFTRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YAAVETCRDYGGNERLTL 272


>gi|304317930|ref|YP_003853075.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779432|gb|ADL69991.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 277

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 143/263 (54%), Gaps = 14/263 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESI--HRILGWRDFYNV 63
           +S + L    G S   ++++ D  L D    F     V  L+   +    I+G + F  +
Sbjct: 24  ESEALLSFTLGASKEYLLINRDKELTDDS--FNKYMEVLDLRKSGMPYQYIVGEKHFMGL 81

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +S     PR +TE+LV+  L     R++  D V  LD+GTG+GA+ +++ K     K
Sbjct: 82  IFNVSPSVLIPRNDTEILVEEVLK----RLKSGDTV--LDIGTGSGAIAVSIAKYKDV-K 134

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGL-FDVIVSNPPYIESVIVD 181
              VDIS  ALE+AK NA  NGVS++   ++SD FSS+ +G+ FD+IVSNPPYI S  ++
Sbjct: 135 VYAVDISDGALEVAKENADINGVSDKVIFIKSDLFSSIPDGIRFDLIVSNPPYIRSNEIN 194

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L  EV+  +P+I+LDGG DGL+ YR I      ++   G+ + E+G++Q  DV  I   
Sbjct: 195 ELQEEVKR-EPKIALDGGEDGLTFYRRIVKDSVNYIKFGGIIAFEVGFDQAWDVKDILVD 253

Query: 242 RKLFLVNAFKDYGGNDRVLLFCR 264
                +   KD  G DRV+L  R
Sbjct: 254 GGYSDIEVVKDLQGIDRVVLGKR 276


>gi|329929004|ref|ZP_08282806.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus sp. HGF5]
 gi|328936993|gb|EGG33422.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus sp. HGF5]
          Length = 296

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 126/244 (51%), Gaps = 10/244 (4%)

Query: 1   MQALRDSHSFLCRVTGLSS---HQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGW 57
           M+  R++   L  V GLS    +  + DP     + +R  L  AI R  +      I+G 
Sbjct: 31  MEPQRNAQLLLEHVLGLSGTSYYMALTDP---FPEGRRLALEEAITRKAEGVPAQYIIGE 87

Query: 58  RDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALL 116
           ++FY     ++     PRPETELLV++ L +      + D  ++++D+GTG+GA+ + L 
Sbjct: 88  QEFYGRPFDVTPAVLIPRPETELLVEAVLKYGQELTPRPDGGLKVVDIGTGSGAIAITLA 147

Query: 117 KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYI 175
            +S  +     DIS  ALE+A  NA   G   R +  Q +      G+  D++VSNPPYI
Sbjct: 148 LQSKGWDVFASDISSDALEVAARNAKKLGA--RVEFRQGNLLEPFAGMGPDILVSNPPYI 205

Query: 176 ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDV 235
            +  ++ L  EVRD++PR +LDGG DGL+ YR +   +S       L + E+G  Q  DV
Sbjct: 206 PAEDIEELQPEVRDYEPRTALDGGPDGLNPYRIMMAQLSLLSAPPRLIAFELGMGQAGDV 265

Query: 236 VRIF 239
             + 
Sbjct: 266 AELL 269


>gi|324992932|gb|EGC24852.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK405]
 gi|325687438|gb|EGD29459.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK72]
          Length = 276

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 116/218 (53%), Gaps = 12/218 (5%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H+    I+G  DF+ + L +      PRPETE LV+  L+ +     +   + ILD+G
Sbjct: 63  LAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSEN-----RESSLSILDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ L L    P ++    D+S  AL +A  NA + G+S  F  +QSD F ++ G F
Sbjct: 118 TGSGAIALTLANSRPDWQITASDLSGDALSLATENAQSCGLSLTF--IQSDCFEAISGNF 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     D +GL V   +P ++L    DG + YR IA+    HL K G   +
Sbjct: 176 DIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYAVYRKIAEQAGDHLTKKGKIYL 235

Query: 226 EIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVL 260
           EIGY Q   V  +   +K F    +   KD  G DR++
Sbjct: 236 EIGYKQGDGVRELL--KKSFPQKRIRVLKDRFGKDRMV 271


>gi|157145533|ref|YP_001452852.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Citrobacter koseri ATCC BAA-895]
 gi|157082738|gb|ABV12416.1| hypothetical protein CKO_01276 [Citrobacter koseri ATCC BAA-895]
          Length = 277

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 130/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L D QR  L   + R  + E +  + G R+F+++ 
Sbjct: 22  RDAEILLGHVTGKARTFILAFGETALTDTQREQLAQLLARRQRGEPVAHLTGIREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----DSPCRILDLGTGTGAIALALATERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQSDWF+++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAGRNAQHLAI-HNVRILQSDWFAALPGQQFDMIVSNPPYIDAHDPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +G++    I       L   G   +E G+ Q V V        
Sbjct: 196 QGDVR-FEPLSALVADDNGMADITHIIAQARHALAPGGYLLLEHGWQQGVAVRTALAQAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 255 YVQVETCRDYGDNERITL 272


>gi|303228389|ref|ZP_07315222.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella atypica ACS-134-V-Col7a]
 gi|302516891|gb|EFL58800.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella atypica ACS-134-V-Col7a]
          Length = 289

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 132/259 (50%), Gaps = 9/259 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D    L  V G +   +  + D  L+  +       ++   K  S+  + G +DF  +  
Sbjct: 30  DGEVLLSHVLGKNRIYLYTNYDQPLEQEELDRFRPLVIERAKGYSVASLTGTKDFMGLTF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PRP+TE LV+    + L    ++D +RILD+ TG G + L+LL   P   G+
Sbjct: 90  AVNDKVLIPRPDTETLVE----YVLSTYHQQDAIRILDMCTGPGTILLSLLHYLPTATGM 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG---LFDVIVSNPPYIESVIVDC 182
           G+DIS  ALEIA  N     +  R +  +SD FS +E    LFDVIVSNPPYI       
Sbjct: 146 GLDISRDALEIATKNQEAFKLENRSEFHESDMFSYLEHHNELFDVIVSNPPYIRLEDKKI 205

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  +V + +P I+L GG DGL  YR +A     +L   GL + E+GY+Q  DV  + ES 
Sbjct: 206 LSPDVLN-EPHIALFGGEDGLDFYRQLAMECVTYLKPYGLVAFEVGYDQAEDVKSLLESV 264

Query: 243 KLFLVNAF-KDYGGNDRVL 260
             ++  +F  D  G +RV+
Sbjct: 265 GSYVDISFAADLAGINRVV 283


>gi|262375290|ref|ZP_06068523.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter lwoffii SH145]
 gi|262309544|gb|EEY90674.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter lwoffii SH145]
          Length = 272

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 127/258 (49%), Gaps = 10/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  +T + S  +++  D  L   Q     + + R    E +  + G + F+ + 
Sbjct: 19  QENAWLLEHITKIDSFDLLMKKDQELTPEQEQAYKDGLARIAAGEPLAYVTGSQPFWTLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++ DT  PRP+TE+LV++ L   LP     +  R++DLGTGTGA+ L+L  E   +  
Sbjct: 79  LKVTKDTLVPRPDTEVLVETVLKLDLP-----EDARVVDLGTGTGAIALSLASERSNWTV 133

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
              DI    LE+AK NA  + + E  + +   W        FD IVSNPPYI++   D +
Sbjct: 134 TASDIYEPTLEVAKYNAEQHDI-ENVEFVLGSWLKPFGRQFFDAIVSNPPYIDA---DDV 189

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
            ++    +P  +L     GL+    I     +HL  +G   +E GYNQ   V  +F+   
Sbjct: 190 HMQNLATEPERALVADKKGLADIEMIILQAKKHLTVNGWVVLEHGYNQADAVQHLFKQAG 249

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   KDYGGNDRV L
Sbjct: 250 YKQVRTVKDYGGNDRVTL 267


>gi|239617253|ref|YP_002940575.1| modification methylase, HemK family [Kosmotoga olearia TBF 19.5.1]
 gi|239506084|gb|ACR79571.1| modification methylase, HemK family [Kosmotoga olearia TBF 19.5.1]
          Length = 282

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 7   SHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLT 66
           + + L  +  +  H+V VD  + +D +    L +A+ R    E +  I+GW+ F   +L 
Sbjct: 26  TFTLLESIAMIEKHKVFVDTATEIDTKTCKLLFDAVKRLKAGEPLDYIIGWKYFLGAKLN 85

Query: 67  LSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVG 126
           L S    PRPETE LV+  +       + ++V    D+GTG+GA+ +AL K  P  K   
Sbjct: 86  LDSRVLIPRPETEELVEMIIN----EHKGKNVKAFADVGTGSGAIAIALAKHFPASKIYA 141

Query: 127 VDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFD---VIVSNPPYIESVIVDCL 183
            DIS  ALE+A  NA  NGV  R   L     + +E   D   +IVSNPPY+++ +++ L
Sbjct: 142 TDISKPALELAFENAKINGVEGRIAFLHGKNLNPLEAYMDEIEIIVSNPPYVKTTVLESL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYR 207
              V+D++P I+LDGG DG++ +R
Sbjct: 202 DKRVKDYEPIIALDGGEDGMNFFR 225


>gi|317153067|ref|YP_004121115.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943318|gb|ADU62369.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 284

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 132/264 (50%), Gaps = 12/264 (4%)

Query: 7   SHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLT 66
           +   +  V GL+   + ++ D  L   +   + +   R    E +  +LG R+FY +  +
Sbjct: 26  AQVLVAEVLGLTRLGLSLERDRALTPEETDRIRSLAARRASGEPLAYLLGRREFYGLDFS 85

Query: 67  LSSDTFEPRPETELLVDSAL-AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
           ++ D   PRPETE ++++ L AFS         VR  DLGTG+G + + L    P   G+
Sbjct: 86  VTPDVLIPRPETEHVIEAVLNAFS-----PDTPVRFADLGTGSGILAVTLAHCFPHATGL 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCL 183
            VD+S  AL +A+ NA  +GV +R   +Q D+   +  +G FD+IVSNPPY+     +  
Sbjct: 141 AVDLSGPALAVARRNARAHGVHDRIAFVQGDFTGPILGKGRFDLIVSNPPYVTDEEFERA 200

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             EV  F+PR +L  G DGL H R +       L   GL  +EIG  Q V+ V I  S +
Sbjct: 201 SREVTGFEPRTALVSGPDGLDHIRAMLPRALEALRPGGLLLMEIGCGQ-VEGVNIITSNQ 259

Query: 244 LFL---VNAFKDYGGNDRVLLFCR 264
                 V   KD  G+DRV+   R
Sbjct: 260 CLESRDVGVIKDLAGHDRVVSMRR 283


>gi|227328866|ref|ZP_03832890.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 281

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/258 (33%), Positives = 138/258 (53%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L+  ++  LT  + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKARTFLLAFGETELNAAEQQQLTELLARREQGEPIAYLIGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP+        +LDLGTGTGA+ LAL  E    + 
Sbjct: 82  LAVSPATLIPRPDTECLVEQAL-LRLPQTP----CAVLDLGTGTGAIALALASERRDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
            GVD+   A+ +A  NA   G+ +    L   W+S ++   F +I SNPPYI++  V   
Sbjct: 137 TGVDVQPDAVALATKNAQQLGL-DNASFLSGSWYSPLDHTRFALIASNPPYIDADDVHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  RTI +    +L+      +E G+ Q   V ++ ++R 
Sbjct: 196 QGDVR-FEPASALIAADNGLADLRTIIESAPHYLDDGAWLLLEHGWQQADMVRQLLQARG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              +   +DYGGNDRV L
Sbjct: 255 FTQIETCQDYGGNDRVSL 272


>gi|160940108|ref|ZP_02087453.1| hypothetical protein CLOBOL_04997 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436688|gb|EDP14455.1| hypothetical protein CLOBOL_04997 [Clostridium bolteae ATCC
           BAA-613]
          Length = 285

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 118/214 (55%), Gaps = 9/214 (4%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGA 110
           +  + G ++F      ++     PR +TE LV+  L     R EKR    +LD+ TG+G 
Sbjct: 73  LQHLTGTQEFMGFEFLVNEHVLIPRQDTETLVELVLEEQNDR-EKR----VLDMCTGSGC 127

Query: 111 VCLALLKESPFFKGVGVDISCKALEIAKSNA--VTNGVSERFDTLQSDWFSSVEG--LFD 166
           + ++L     +     +D+S +AL++A  N   +  G    F+  +S+ FS++E    FD
Sbjct: 128 IAISLALMGRYRHVAALDVSAEALKVAAGNRDRLLGGYEGGFELFESNMFSALETDRTFD 187

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           VIVSNPPYI S +++ L  EVRD +PRI+LDG  DGL+ YR +A+    HL + G   +E
Sbjct: 188 VIVSNPPYIPSRVIEGLAPEVRDHEPRIALDGSDDGLTFYRILAEEARNHLAEGGSIYME 247

Query: 227 IGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           IGY+Q   V  +F S     V  F+D  G DRV+
Sbjct: 248 IGYDQSEAVEGLFRSGGYRDVRTFQDLAGQDRVV 281


>gi|329113398|ref|ZP_08242179.1| Bifunctional methyltransferase [Acetobacter pomorum DM001]
 gi|326697223|gb|EGE48883.1| Bifunctional methyltransferase [Acetobacter pomorum DM001]
          Length = 292

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 137/260 (52%), Gaps = 7/260 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           R++   L     L+  Q++    +     + FF  + + R   HE    I G + F+++ 
Sbjct: 34  REARLLLIHALSLTPEQLLARSPTENVPSEPFF--SYVKRRAAHEPFAYITGSKGFWSLD 91

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  +  PR +TE L+ S L +   R ++  V  ILDLGTGTG + LA L E P  +G
Sbjct: 92  LAVSPASLVPRGDTETLITSLLEY---RPDQTSVQNILDLGTGTGCLLLAALAEYPKARG 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDC 182
           VGVDI+ +A  +A +NA   G+ +    + ++W +++     FDV++SNPPYI +  +  
Sbjct: 149 VGVDINPQAAMLAHANAQRCGMQDHALFIAAEWDAALAPNARFDVVLSNPPYIPTSDLAD 208

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EVR+ +P  +LDGG DGLS YR +   +   L   G+  +EIG  Q+  +  +  + 
Sbjct: 209 LMREVREHEPVRALDGGNDGLSAYRYLCGRLPFLLVDGGVAVLEIGIGQEEALRALAATN 268

Query: 243 KLFLVNAFKDYGGNDRVLLF 262
            L +V+   D  G  R ++ 
Sbjct: 269 ALRVVDVKADLAGIARAVVL 288


>gi|154498436|ref|ZP_02036814.1| hypothetical protein BACCAP_02425 [Bacteroides capillosus ATCC
           29799]
 gi|150272504|gb|EDM99689.1| hypothetical protein BACCAP_02425 [Bacteroides capillosus ATCC
           29799]
          Length = 287

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 131/258 (50%), Gaps = 6/258 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   +C   G +  Q + D      D     +   + R L+ E +  ++G  +FY + L
Sbjct: 27  EARELVCFAAGKNREQFLRDMSLYASDEVEAKVAELMNRRLEGEPVAYLIGEWEFYGLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S D   PR +TE+L + A+   L      +  R+LDL  G+G V LA+   +P  + V
Sbjct: 87  DISRDVLIPRADTEVLAEQAI---LAARAAGEGARVLDLCAGSGCVGLAVAANAPQCRTV 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWF---SSVEGLFDVIVSNPPYIESVIVDC 182
             D+S +AL+I + N   N ++ R   +Q+D     SSV   FDVI SNPPYI +  +D 
Sbjct: 144 LADVSEEALKICRQNIRRNDLNARVTCVQADARQAPSSVLWDFDVIASNPPYIPTRDIDG 203

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L   VRD++P ++LDGG DGL  YR IA+     L   G+   E+G  Q  DV +I    
Sbjct: 204 LDSSVRDYEPHLALDGGDDGLDFYRDIAEKWRTALRLGGVLLFEVGIGQAADVEQILARC 263

Query: 243 KLFLVNAFKDYGGNDRVL 260
               +  F+D GG  RV+
Sbjct: 264 GYEDIETFQDTGGIWRVV 281


>gi|260914190|ref|ZP_05920663.1| protein methyltransferase HemK [Pasteurella dagmatis ATCC 43325]
 gi|260631823|gb|EEX50001.1| protein methyltransferase HemK [Pasteurella dagmatis ATCC 43325]
          Length = 308

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 132/267 (49%), Gaps = 16/267 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VT  +   ++  P++ L   +   L   + R  K E I  ILG ++F+++ L
Sbjct: 38  DAMVLLSEVTQKTRAYILAFPETHLSADKLKQLEKYLTRRAKGEPIAYILGEKEFWSLPL 97

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEK---RDVVRILDLGTGTGAVCLALLKESPFF 122
            +S  T  PRP+TE+LV+ AL  +  R+        + ILDLGTGTGA+ LAL  E    
Sbjct: 98  KVSKHTLIPRPDTEILVEQALEIAKQRLNSSYFSGELTILDLGTGTGAIALALASELKML 157

Query: 123 KG--------VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNP 172
                     + VD   +A+E+A+ NA  N +   F  LQS WF +++    FDVIVSNP
Sbjct: 158 TQKCGANLNILAVDRIAEAVELARENAKYNHLEVTF--LQSSWFDALDPSIKFDVIVSNP 215

Query: 173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQK 232
           PYI+         +VR F+P  +L    +G +  R I +   + L   G   +E G+ Q 
Sbjct: 216 PYIDEKDSHLTQGDVR-FEPLSALVAEEEGYADLRHIIEQAPQFLKPQGYLLLEHGWLQG 274

Query: 233 VDVVRIFESRKLFLVNAFKDYGGNDRV 259
             V  IF       V   KDYG N+RV
Sbjct: 275 EKVRSIFTENNWQQVQTLKDYGNNERV 301


>gi|254244444|ref|ZP_04937766.1| hypothetical protein PA2G_05302 [Pseudomonas aeruginosa 2192]
 gi|126197822|gb|EAZ61885.1| hypothetical protein PA2G_05302 [Pseudomonas aeruginosa 2192]
          Length = 276

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 120/221 (54%), Gaps = 8/221 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R    E +  ILG + F+++ L ++  T  PRP+TELLV++ALA         D   +
Sbjct: 58  IARRRNGEPVAYILGHQGFWSLDLEVAPHTLIPRPDTELLVETALA-----TLTADTATV 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTGTGA+ LAL  E P +    VD   +A+ +A+ N     + E  +  +S WFS++
Sbjct: 113 LDLGTGTGAIALALASERPLWTVTAVDRVEEAVALAERNR-QRLLLENVEVRRSHWFSAL 171

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           +G  F +IV NPPYI +        +VR F+P+ +L  G DGL   R I     +HL  +
Sbjct: 172 DGRRFRMIVGNPPYIPASDPHLSEGDVR-FEPKSALVAGSDGLDDIRQIVAQAPQHLLDE 230

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E GY+Q   V  +  +R    V+  +D GGN+R+ L
Sbjct: 231 GWLLLEHGYDQGAAVRELLGARGFAGVHTLRDLGGNERITL 271


>gi|225175857|ref|ZP_03729850.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dethiobacter alkaliphilus AHT 1]
 gi|225168781|gb|EEG77582.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Dethiobacter alkaliphilus AHT 1]
          Length = 283

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 126/257 (49%), Gaps = 5/257 (1%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           R++   L  + G  +  +       L   Q       + R    E    + G ++F  + 
Sbjct: 26  REAQFLLTALLGCDAAWLYAHDQEKLTAPQWAEFQAWLARRATGEPFAYLAGQKEFMGLC 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
             ++ D   PRPETE LV++        ++     RIL++G G+GAV ++L K  P  + 
Sbjct: 86  FAVTPDVLIPRPETEFLVEAVAE----ELQAHTSPRILEIGAGSGAVAVSLAKLLPKARV 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           V VD+S  ALEIA+ NA  +GV+ R + L  D ++ V +  FD +VSNPPYI +  +  L
Sbjct: 142 VAVDVSQAALEIAQKNAARHGVAGRVEFLAGDLYAPVADEYFDAVVSNPPYISAADILKL 201

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +V+DF+PR++L GG DGL  YR +   +    N+  + + E+G  Q   V  +     
Sbjct: 202 QCDVKDFEPRLALCGGEDGLDFYRRLTGELDVLSNRPKMLAFEVGMGQAQAVAALCLKAG 261

Query: 244 LFLVNAFKDYGGNDRVL 260
                  KD  G DR++
Sbjct: 262 YENTRQIKDLAGIDRII 278


>gi|15604677|ref|NP_221195.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia prowazekii str. Madrid E]
 gi|6225501|sp|Q9ZCB3|HEMK_RICPR RecName: Full=Bifunctional methyltransferase; Includes: RecName:
           Full=HemK protein homolog; AltName: Full=M.RprHemKP;
           Includes: RecName: Full=tRNA
           (guanine-N(7)-)-methyltransferase; AltName:
           Full=tRNA(m7G46)-methyltransferase
 gi|3861372|emb|CAA15271.1| POSSIBLE PROTOPORPHYRINOGEN OXIDASE (hemK) [Rickettsia prowazekii]
 gi|292572508|gb|ADE30423.1| Methylase of polypeptide chain release factors [Rickettsia
           prowazekii Rp22]
          Length = 518

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 134/266 (50%), Gaps = 15/266 (5%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  VT      +++  +  L + +       + R L HE I  I+G ++FY+    ++ 
Sbjct: 31  LLQHVTNKPIEHLLIKLNEQLSEAEIEAFEKLLERRLAHEPIAYIIGVKEFYSREFIVNK 90

Query: 70  DTFEPRPETELLVDSALAFSLPR--------IEKRDVV------RILDLGTGTGAVCLAL 115
               PR +TE+LVD  +   + R        ++  D V       IL+LGTG+G + ++L
Sbjct: 91  HVLIPRIDTEVLVDVVIGLVVSRNNLHMFSKLKSLDSVLTTQSYNILELGTGSGCIAISL 150

Query: 116 LKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPY 174
           L E P    +  DIS  A+++AKSN++   V++R   + S+WF  ++   FD IVSNPPY
Sbjct: 151 LCELPNTNIIATDISVDAIKVAKSNSIKYNVTDRIQIIHSNWFEKLDKQKFDFIVSNPPY 210

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I       + +E  +++P I+L    DGL  Y  IA    + L  +G   +EIG++Q   
Sbjct: 211 ISHTEKLKMAIETINYEPSIALFAEEDGLEAYSIIAKNAKQFLKPNGKIILEIGFSQAAK 270

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVL 260
           V +IF +    +   ++D   ++RV+
Sbjct: 271 VSKIFLNYGYNIDYIYRDLQSHNRVI 296


>gi|270157831|ref|ZP_06186488.1| protein-(glutamine-N5) methyltransferase [Legionella longbeachae
           D-4968]
 gi|289163903|ref|YP_003454041.1| methyltransferase HemK [Legionella longbeachae NSW150]
 gi|269989856|gb|EEZ96110.1| protein-(glutamine-N5) methyltransferase [Legionella longbeachae
           D-4968]
 gi|288857076|emb|CBJ10891.1| putative methyltransferase HemK [Legionella longbeachae NSW150]
          Length = 268

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 136/258 (52%), Gaps = 11/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           R++   L  V   +   +   P+++L  +Q     + + +  K   I  ++G R+F+++ 
Sbjct: 14  REAEILLGHVLDKTRAYLFAHPETLLTPKQLAAFEHLMAQRAKGIPIAYLMGQREFWSLD 73

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++  T  PR ETELLV  AL F    I  +    IL+LGTG+GA+ LAL KE P ++ 
Sbjct: 74  LKVNEHTLIPRHETELLVALALEF----IPDQPDTHILELGTGSGAIALALAKERPSWRI 129

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           V  DIS  AL++AK NA  N + E  +   SDWFS + +  +  IV+NPPYI     D  
Sbjct: 130 VACDISEDALKVAKENAQNNKI-ENINFFLSDWFSGIPQRQYHAIVTNPPYIAE---DDP 185

Query: 184 GLEVRD--FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L+  D  F+PR +L    +GL+  + I +    +L   G+  +E G++QK  V  I   
Sbjct: 186 HLQQGDLRFEPRNALVSSQEGLADLQCIIEHGYEYLLPQGMLLLEHGFDQKSKVQAILNR 245

Query: 242 RKLFLVNAFKDYGGNDRV 259
            +   +  ++D  G+DRV
Sbjct: 246 LRYKSIRCWQDIQGHDRV 263


>gi|238895294|ref|YP_002920029.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Klebsiella pneumoniae NTUH-K2044]
 gi|238547611|dbj|BAH63962.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 282

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   +VR  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTGRARTWILAFGETTLSADEAAKLEALLVRRQRGEPIAHLVGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLPTAP----CRILDLGTGTGAIALALASERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA    ++      QSDWFS++ G  F  IVSNPPYI++      
Sbjct: 137 TAVDVMPDAVALALRNAEHLSIAN-VTISQSDWFSALAGQRFATIVSNPPYIDAADPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPLTALVAGDQGLADLAHIIREGRQYLQPGGWMLLEHGWTQGEAVRALFREAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 255 YLDVATCRDYGDNERLTL 272


>gi|152984205|ref|YP_001350645.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pseudomonas aeruginosa PA7]
 gi|150959363|gb|ABR81388.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pseudomonas aeruginosa PA7]
          Length = 276

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 129/257 (50%), Gaps = 8/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G     +   P+ ++         + I R    E +  ILG + F+++ L
Sbjct: 22  DTELLLAAAMGKPRSFLRTWPERIVPREANELFDDWIARRRNGEPVAYILGHQGFWSLDL 81

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TELLV++ALA         D   +LDLGTGTGA+ LAL  E P +   
Sbjct: 82  EVAPHTLIPRPDTELLVETALA-----TLAADSATVLDLGTGTGAIALALASERPLWTVT 136

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
            VD   +A+ +A+ N     + E  +   S WFS+++G  F +IV NPPYI +       
Sbjct: 137 AVDRVEEAVALAERNR-QRLLLENVEVCHSHWFSALDGRRFRMIVGNPPYIPASDPHLSE 195

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L  G DGL   R I +   R+L  +G   +E GY+Q   V  +  +R  
Sbjct: 196 GDVR-FEPKSALVAGNDGLDDIRQIVEQAPRYLLAEGWLLLEHGYDQGAAVRDLLGARGF 254

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   +D GGN+R+ L
Sbjct: 255 AGVRTLRDLGGNERITL 271


>gi|120601500|ref|YP_965900.1| HemK family modification methylase [Desulfovibrio vulgaris DP4]
 gi|120561729|gb|ABM27473.1| [protein release factor]-glutamine N5-methyltransferase
           [Desulfovibrio vulgaris DP4]
          Length = 295

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 126/259 (48%), Gaps = 10/259 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            LC    L    +++ PD ++++      +  + R    E +  I+G ++F+     ++ 
Sbjct: 37  ILCHALSLRRIDIMLTPDRIVEEADCILFSELVARRATGEPLAYIVGEKEFFGRDFAVNP 96

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
            T  PRPETE L+++AL  SL    +    R +D GTG+G + + L  E     G+ +D+
Sbjct: 97  STLIPRPETEHLIETALE-SL----RSGPARFVDAGTGSGCIAVTLCAERADLSGLALDM 151

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEV 187
           S  AL  A  NA  +GV++R   ++ D+ +S+   G  D+  SNPPYI       L  EV
Sbjct: 152 SAPALATASHNARRHGVAQRLAFVRGDFTTSLLRSGSLDLYASNPPYISKAEYTGLSREV 211

Query: 188 RDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF-- 245
           RDF+PR +L  G  GL H   I    +R L   G+  +E G  Q  D+  +F        
Sbjct: 212 RDFEPRSALVPGDTGLEHATAIIAEATRVLRPHGILLMEFGCTQGADMASLFTPYSTLWE 271

Query: 246 LVNAFKDYGGNDRVLLFCR 264
           +V   +D  G DR  +F R
Sbjct: 272 MVEVRRDLAGLDR-FIFAR 289


>gi|306820961|ref|ZP_07454581.1| protein-(glutamine-N5) methyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551075|gb|EFM39046.1| protein-(glutamine-N5) methyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 279

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 127/241 (52%), Gaps = 8/241 (3%)

Query: 24  VDPDSVLDDRQRFFLTNAIVRSLK-HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLV 82
           +D    LDD Q+  L    V+ LK H+ IH I+G RDFY     +      PR +TE+LV
Sbjct: 43  LDEKIALDDEQQIKL---FVQQLKNHKPIHYIIGQRDFYGYDFLVDEHVLIPRSDTEILV 99

Query: 83  DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
           ++A+     + +    + I   G G+G + + LLK+        VDI+  A++I+K NA 
Sbjct: 100 ENAVNLLKNKKKDLKGLEI---GVGSGIISITLLKKLKNLSMTAVDINDYAIDISKKNAE 156

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
             GVS+R   ++SD F +V G +D I+SNPPYI+   +  L  +V++++P  +LDG  +G
Sbjct: 157 NLGVSDRLKLIKSDLFENVIGKYDFIISNPPYIDEKDMADLPEKVKNYEPYSALDGKKNG 216

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVLL 261
           +  Y  I       LN       EIGYNQ   +   FE+      V   +DYG NDRV +
Sbjct: 217 MYFYNEIIKSGRTFLNDKFHIFFEIGYNQGEMIRHSFENCGYEADVKIIQDYGKNDRVAI 276

Query: 262 F 262
           +
Sbjct: 277 Y 277


>gi|238651092|ref|YP_002916950.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia peacockii str. Rustic]
 gi|238625190|gb|ACR47896.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent
           methyltransferase/tRNA (m7G46) methyltransferase
           [Rickettsia peacockii str. Rustic]
          Length = 524

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 131/262 (50%), Gaps = 21/262 (8%)

Query: 22  VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELL 81
           ++++ D  L++ +       + R LKHE I  I G ++FY+    ++     PR +TE+L
Sbjct: 43  LLINLDEQLNEAKIEAFEKLLARRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVL 102

Query: 82  VDSALAFSL-----PRIEKRD---------------VVRILDLGTGTGAVCLALLKESPF 121
           VD            P  ++ D                + IL+LGTG+G + ++LL E   
Sbjct: 103 VDVVFQCHSRESGNPEKKQPDPCFRGNDISENCNDKFLNILELGTGSGCIAISLLCELQN 162

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
              +  DIS  A++I KSNA    V++R   + S+WF ++E   FD IVSNPPYI     
Sbjct: 163 ANVIATDISLDAIDIIKSNAAKYEVTDRIQIIHSNWFENIETQKFDFIVSNPPYIAHSEK 222

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
             + +E  +++P I+L    DGL  Y  IA+   + L  +G   +EIG+ Q+  V +IF 
Sbjct: 223 SEMAIETINYEPSIALFAEKDGLQAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFL 282

Query: 241 SRKLFLVNAFKDYGGNDRVLLF 262
                + + +KD  G+ RV+L 
Sbjct: 283 DHGYNIESVYKDLQGHSRVILL 304


>gi|145298194|ref|YP_001141035.1| protein-glutamine N-methyltransferase HemK [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850966|gb|ABO89287.1| Protein-glutamine N-methyltransferase HemK [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 289

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 127/267 (47%), Gaps = 12/267 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC +       ++  P+  LD  Q+  L   + R L  E I  ++G R+F+++ L
Sbjct: 23  DADVLLCHLLDCRRSYLMTWPERELDAAQQDRLQGWLTRRLAGEPIAHLVGEREFWSLPL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE+LV+ ALA   P+    D     +LDLGTGTGA+ LAL  E P   
Sbjct: 83  KVSPATLIPRPDTEVLVEQALARLPPKPASPDQAPCALLDLGTGTGAIALALKSERPDAD 142

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS-------SVEGLFDVIVSNPPYIE 176
              VD   +A  +A+ N+   G+          WF        S    F +IVSNPPYI+
Sbjct: 143 VWAVDRMPEAAALARDNSAALGLP--ITVRDGSWFEPLCDPLLSQAPRFAMIVSNPPYID 200

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+PR +L     GL+  R I  G   HL   G   +E G+ Q   V 
Sbjct: 201 GADPHLNKGDVR-FEPRSALVADEQGLADIRLIVAGAPAHLCPGGWLLLEHGWQQGEAVR 259

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLLFC 263
           ++   +    V   +DYG N+RV L C
Sbjct: 260 QLLLQQGFSRVETVRDYGDNERVTLGC 286


>gi|303230838|ref|ZP_07317585.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302514598|gb|EFL56593.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella atypica ACS-049-V-Sch6]
          Length = 289

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 124/239 (51%), Gaps = 8/239 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D    L  V G +   +  + D  L+  +       ++   K  S+  + G +DF  +  
Sbjct: 30  DGEVLLSHVLGKNRIYLYTNYDQPLEQEELDRFRPLVIERAKGHSVASLTGTKDFMGLTF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PRP+TE LV+    + L    ++D +RILD+ TG G + L+LL   P   G+
Sbjct: 90  AVNDKVLIPRPDTETLVE----YVLSSYHQQDSIRILDMCTGPGTILLSLLHYLPTATGM 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG---LFDVIVSNPPYIESVIVDC 182
           G+DIS  ALEIA  N     +  R +  +SD FS +E    LFDVIVSNPPYI     + 
Sbjct: 146 GLDISRDALEIATKNQEAFKLENRSEFHESDMFSYLEHHNELFDVIVSNPPYIRLEDKEI 205

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
           L  +V + +P I+L GG DGL  YR +A    ++L   GL + E+GY+Q  DV  + E+
Sbjct: 206 LSPDVLN-EPHIALFGGEDGLDFYRHLAMECVKYLKPYGLVAFEVGYDQAEDVKSLLEA 263


>gi|261343908|ref|ZP_05971553.1| protein-(glutamine-N5) methyltransferase [Providencia rustigianii
           DSM 4541]
 gi|282568294|gb|EFB73829.1| protein-(glutamine-N5) methyltransferase [Providencia rustigianii
           DSM 4541]
          Length = 277

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 136/261 (52%), Gaps = 10/261 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L   TG S   ++   ++ L   +   L   + R    E I  I+G R+F++
Sbjct: 20  AKRDAQILLQHATGRSRTYILAFDETELSAHELQQLEELLQRREFGEPIAYIVGEREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +S  T  PRP+TE LV+ AL   LP  +     RILDLGTGTGA+ LAL  E P  
Sbjct: 80  LPLYVSPATLIPRPDTECLVEQAL-IRLPSTD----CRILDLGTGTGAIALALASERPNS 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIV 180
             +GVD + +A+ +A+ N     + + RF   QSDWF+S+   LFD+IVSNPPYI+   +
Sbjct: 135 TVIGVDFNPEAVVLAERNQQRLSIFNVRFS--QSDWFTSLSNELFDMIVSNPPYIDEGDI 192

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                +VR F+P  +L     GLS    I     R+L + G   +E G+ Q + V  +F 
Sbjct: 193 HLNQGDVR-FEPATALIAEEHGLSDLAHIIAESKRYLKQQGWLLLEHGWQQGLAVRELFS 251

Query: 241 SRKLFLVNAFKDYGGNDRVLL 261
                 +    DYGG DRV L
Sbjct: 252 ENGYTNIETCLDYGGKDRVSL 272


>gi|326796199|ref|YP_004314019.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Marinomonas mediterranea MMB-1]
 gi|326546963|gb|ADZ92183.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Marinomonas mediterranea MMB-1]
          Length = 278

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 117/220 (53%), Gaps = 9/220 (4%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E I  ++G +DF+ + L +S  T  PRP+TE LV+ AL   +  +EK +   ILD
Sbjct: 62  RRLVGEPIAYLIGKQDFWTLELDVSPTTLIPRPDTERLVEVALDL-IAGVEKPN---ILD 117

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-- 161
           LGTGTGA+ LAL  E       G D   +A+E+A  NA  N +S  F  + SDWFS V  
Sbjct: 118 LGTGTGAIALALAYERKDALVSGADCVKQAVELATRNAEKNALSVNF--IHSDWFSEVPS 175

Query: 162 EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
           +  F +IVSNPPYI+         +VR F+P  +L    +G+     I      +L+  G
Sbjct: 176 DNQFHLIVSNPPYIDPNDKHLSQGDVR-FEPDSALTADQEGMGDINRILSEAPHYLHDTG 234

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             + E GY+Q   V   F SR    V  F DYGGNDRV +
Sbjct: 235 WLAFEHGYDQGEKVRLAFASRGFLSVETFADYGGNDRVTI 274


>gi|260753917|ref|YP_003226810.1| modification methylase, HemK family [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553280|gb|ACV76226.1| modification methylase, HemK family [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 286

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 145/276 (52%), Gaps = 18/276 (6%)

Query: 2   QALRDSHSFLCRVTG--------LSSHQVIVDPDSVL-----DDRQRFFLTNAIVRSLKH 48
           +ALR++   L  V+         L +H + ++ D++L     +         AI R  ++
Sbjct: 16  EALREAARDLATVSMTARLDAELLMAHSLGIERDALLLGSWGEKEAPLSFFEAIKRRKQN 75

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  ILG+RDF+ +RLT++ D   PRP++E L+++A+A+   R +      ILDLGTG+
Sbjct: 76  EPVAYILGYRDFWTLRLTVTPDVLIPRPDSETLIETAIAYF--REQAFLPENILDLGTGS 133

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVI 168
           GA+ LA L E    KG+GVD S +A++IA+ NA   G   R +     W   ++  FD++
Sbjct: 134 GALLLAALDEWKDAKGLGVDASPEAIKIARLNADKCGALPRVEFKIGHWGRGIQQKFDLL 193

Query: 169 VSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIG 228
           + NPPYI    +  +  +V  ++P ++L  G +GL  YR I   +   L + G+  +EIG
Sbjct: 194 LCNPPYIARDAM--MPADVLHYEPHLALFSGDEGLDDYREIIPEIPSLLTERGIACLEIG 251

Query: 229 YNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
           ++Q  +V  I +   L     F D     R +L  R
Sbjct: 252 FDQAENVSMIAKETGL-RSRIFYDLEQRPRCVLLSR 286


>gi|299769518|ref|YP_003731544.1| methylase of polypeptide chain release factor [Acinetobacter sp.
           DR1]
 gi|298699606|gb|ADI90171.1| methylase of polypeptide chain release factor [Acinetobacter sp.
           DR1]
          Length = 271

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 113/216 (52%), Gaps = 10/216 (4%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP     +   I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEILVETVLNLTLP-----NTANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDV 167
           GA+ LAL  E P +     DI    LE+AK NA+ + + +R       WF ++E   FD+
Sbjct: 118 GAIALALASERPDWFVTATDIYAPTLEVAKENALAHNL-QRVKFACGAWFEALEPQKFDL 176

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E 
Sbjct: 177 IVSNPPYIDP---EDEHMQALATEPRRALVADHQGLADIEIIIAQGKNWLKPQGWIALEH 233

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           GY+Q   V  IF       +   +DYG NDRV L C
Sbjct: 234 GYDQGQAVRNIFAEHGFSEIKTIQDYGQNDRVTLAC 269


>gi|320538899|ref|ZP_08038575.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Serratia symbiotica str. Tucson]
 gi|320031059|gb|EFW13062.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Serratia symbiotica str. Tucson]
          Length = 282

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 133/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q+  L   +VR  + E +  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGRARTFLLAFDETRLTPHQQQQLEALLVRREQGEPVAYLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++S  T  PRP++E LV    A +L R+       ILDLGTGTGA+ LAL  E P    
Sbjct: 82  LSVSPATLIPRPDSECLV----ALALERLPIASC-HILDLGTGTGAIALALASERPDCTV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
           +GVD+   AL +A+ NA    +S     LQ +WFSS+    F +I SNPPYI++      
Sbjct: 137 IGVDVQPDALALAQHNARKLTISN-VQFLQGNWFSSLAPQHFALIASNPPYIDADDAHLT 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+    I     +HL   G   +E G+ Q   V  +  +  
Sbjct: 196 QGDVR-FEPASALVAAQQGLADLDAIVRQAPQHLQPQGWLLLEHGWQQGRSVRALMLAAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V  ++DYG N+RV L
Sbjct: 255 FMAVATYRDYGNNERVTL 272


>gi|319939133|ref|ZP_08013497.1| protoporphyrinogen oxidase [Streptococcus anginosus 1_2_62CV]
 gi|319812183|gb|EFW08449.1| protoporphyrinogen oxidase [Streptococcus anginosus 1_2_62CV]
          Length = 276

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 8/217 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H     I+G  +F+     +      PRPETE LV+  L+ +     +   +++LD+G
Sbjct: 63  LVHRPAQYIIGNAEFHGHSFKVDERVLIPRPETEELVNLILSEN-----QNSSLKVLDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ L+L  E   ++    DIS  AL++A+ NA    V+   D +QSD F ++ G +
Sbjct: 118 TGSGAIALSLAAERANWQVTASDISQDALDLAQENAEAIDVA--IDFVQSDCFQAITGKY 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     + +GL V   +P ++L    DG + YR IA+   +HL + G   +
Sbjct: 176 DIIVSNPPYISETDREEVGLNVLASEPHLALFAEEDGYAVYRKIAENAQKHLTEKGKIYL 235

Query: 226 EIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVLL 261
           EIGY Q   V +IFES      +   +D  G DR+++
Sbjct: 236 EIGYKQGEHVKKIFESAFPKMRIRILQDQFGKDRMVV 272


>gi|297183484|gb|ADI19615.1| methylase of polypeptide chain release factors [uncultured SAR11
           cluster bacterium HF0770_37D02]
          Length = 282

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 130/256 (50%), Gaps = 5/256 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  + G S   ++V+    +  +      +AI R +K E I  I G ++F++   
Sbjct: 25  DAEIILSDIMGTSKEFLMVNNQINISKKTIKKYNSAIKRRIKKEPIAYITGKKEFWSQDF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRPETELL+   + F      K   + +LD+GTG+G + L++LKE  F  G 
Sbjct: 85  AVNQATLVPRPETELLIYWVINFF-----KNRKINVLDIGTGSGCILLSILKELNFSTGT 139

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           G+DIS KA++ A+ N+    V  R      D      G +D+IVSNPPYI S  +  L  
Sbjct: 140 GIDISAKAIKTARVNSKNLNVVYRSKFKVFDLSKFNIGKYDLIVSNPPYIPSKDIKNLSK 199

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF 245
           ++ + +P ++L GG DGL   + +    +  L ++GL ++EIGY Q   V  I +     
Sbjct: 200 DIINHEPLVALKGGFDGLDLIKKVIYKSNYLLKRNGLLAIEIGYRQYQKVSSILKKHGFR 259

Query: 246 LVNAFKDYGGNDRVLL 261
            +    D+  N R ++
Sbjct: 260 EIRKEYDFNHNVRCII 275


>gi|293609439|ref|ZP_06691741.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827891|gb|EFF86254.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 271

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 114/216 (52%), Gaps = 10/216 (4%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP     +   I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLNLNLP-----NTANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDV 167
           GA+ LAL  E P ++   +DI    LE+AK NA  + + +R       WF ++E   FD+
Sbjct: 118 GAIALALASERPDWQVTAIDIYAPTLEVAKENAQAHDL-QRVKFACGAWFDALEPQKFDL 176

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E 
Sbjct: 177 IVSNPPYIDP---EDEHMQALATEPRRALVADHQGLADIEIIIAQGKNWLKPQGWIALEH 233

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           GY+Q   V  IF       +   +DYG NDRV L C
Sbjct: 234 GYDQGQAVRDIFTEHGFSEIKTIQDYGQNDRVTLAC 269


>gi|306833420|ref|ZP_07466547.1| protein-(glutamine-N5) methyltransferase [Streptococcus bovis ATCC
           700338]
 gi|304424190|gb|EFM27329.1| protein-(glutamine-N5) methyltransferase [Streptococcus bovis ATCC
           700338]
          Length = 276

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 127/244 (52%), Gaps = 14/244 (5%)

Query: 23  IVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLV 82
           I+  +  + ++ +  L   +V+   H S   I G   F ++ L++      PRPETE LV
Sbjct: 40  ILHQNQAITEKDQMLLEQIMVQLTAHRSPQYITGKAYFRDLELSVDERVLIPRPETEELV 99

Query: 83  DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAV 142
           D  L     +   R  +R+LD+GTG+GA+ ++L    P ++    DIS  AL++ K NA+
Sbjct: 100 DLVL-----KENSRADLRVLDIGTGSGAIAISLKAARPNWQVTASDISADALQLVKENAL 154

Query: 143 TNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDG 202
            N V      +QSD FS +   FD+I+SNPPYI     D +G+ V   +P ++L    +G
Sbjct: 155 KNQVE--LTLIQSDVFSQITERFDMIISNPPYIAYDDEDEVGINVLASEPHLALFADENG 212

Query: 203 LSHYRTIADGVSRHLNKDGLCSVEIGYNQ----KVDVVRIFESRKLFLVNAFKDYGGNDR 258
            + YR I +  S HL ++G    EIGY Q    +  + + F +++   V   KD  G DR
Sbjct: 213 FAIYRQIIENASEHLTENGKLYFEIGYKQGEGLRALLSKHFPAKR---VRVIKDMFGKDR 269

Query: 259 VLLF 262
           +++ 
Sbjct: 270 MVVM 273


>gi|88704042|ref|ZP_01101757.1| protoporphyrinogen oxidase [Congregibacter litoralis KT71]
 gi|88701869|gb|EAQ98973.1| protoporphyrinogen oxidase [Congregibacter litoralis KT71]
          Length = 280

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 133/259 (51%), Gaps = 8/259 (3%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A R++   LC         ++  PD+ ++        + + +      +  +LG R+F+
Sbjct: 18  EAQREAQVLLCAALKKPRSYLVAWPDAEVEASAAEHYRHLLAQRASGIPVAYLLGEREFW 77

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
           ++ L ++  T  PRP+TELLV+ AL   L          +LDLGTG+GA+ LAL  E P 
Sbjct: 78  SLTLRVNDATLIPRPDTELLVEQALKLDL-----SPGASVLDLGTGSGAIALALASERPR 132

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIV 180
           ++  GV+ S +ALEIA++N    G+ +     +SDWF++V G  FD+IVSNPPYI     
Sbjct: 133 WQITGVEHSPEALEIARTNGKRLGLKD-VAFHRSDWFTAVRGQRFDLIVSNPPYIAESDG 191

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
                ++R F+PR +L  G DGL   R I       L   G   +E G+ Q   V  +  
Sbjct: 192 HLSSGDLR-FEPRSALVSGADGLDDIRHIIAEAPTWLEPRGRLLLEHGFEQGSTVRALLS 250

Query: 241 SRKLFLVNAFKDYGGNDRV 259
           +R    V + +D  G++RV
Sbjct: 251 TRGFTAVASAEDLAGHERV 269


>gi|170768219|ref|ZP_02902672.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia albertii TW07627]
 gi|170122985|gb|EDS91916.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia albertii TW07627]
          Length = 277

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 131/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D QR  L   + R    E +  + G R+F+++R
Sbjct: 22  RDAEILLEHVTGKGRTWILAFGETQLTDAQREQLDVLLARRRVGEPVAHLTGVREFWSLR 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +SS T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E      
Sbjct: 82  LFVSSATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERTDCDI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+E+AK NA    + +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVELAKRNARHLAI-KNIHILQSDWFSALVGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLSALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIRAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+RV L
Sbjct: 255 YCEVETCRDYGGNERVTL 272


>gi|51891212|ref|YP_073903.1| putative protoporphyrinogen oxidase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854901|dbj|BAD39059.1| putative protoporphyrinogen oxidase [Symbiobacterium thermophilum
           IAM 14863]
          Length = 305

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 114/217 (52%), Gaps = 4/217 (1%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA-FSLPRIEKRDVVRILDLGTG 107
           E +  ILG  +F  +   ++     PR +T  LV+ A+A  +    E R V+R+ D+GTG
Sbjct: 84  EPLQYILGTEEFMGLTFRVTPAVLIPRLDTAALVEQAVARLTGGAAEARGVLRVADIGTG 143

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE---GL 164
           +GA+ +A+    P  + V VD+S +AL +A  NA  NGV++R    Q D  + +    G 
Sbjct: 144 SGAIAVAVAHLLPHAQVVAVDLSPEALAVAAENARLNGVADRVRFRQGDLLAPLAEEGGR 203

Query: 165 FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           F  I+SNPPYI    +  L  EVRD++PR++L  G DGL+ YR +A      L   G   
Sbjct: 204 FAAILSNPPYIREDEIAGLMPEVRDWEPRLALVAGDDGLAFYRRLAREAPAFLEPGGFLG 263

Query: 225 VEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           VE+G  Q   V  +F    L  V   +D  G DR +L
Sbjct: 264 VEVGIGQAPAVAALFREAGLKDVAVCRDTAGVDRAVL 300


>gi|324113972|gb|EGC07946.1| protein-(glutamine-N5) methyltransferase [Escherichia fergusonii
           B253]
          Length = 276

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 130/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGRGRTFILAFGETQLTDEQLQQLDALLARRRAGEPIAHLTGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALE-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA    + +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVALAQRNAQHLAI-KNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  G++    I +     L K G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAGDHGMADIVHIIEHSRAALAKGGYLLLEHGWQQGTAVRQAFIQAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YSNVETCRDYGGNERITL 272


>gi|225568387|ref|ZP_03777412.1| hypothetical protein CLOHYLEM_04464 [Clostridium hylemonae DSM
           15053]
 gi|225162615|gb|EEG75234.1| hypothetical protein CLOHYLEM_04464 [Clostridium hylemonae DSM
           15053]
          Length = 303

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 132/272 (48%), Gaps = 27/272 (9%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLD-DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           D+   L  VTG++       P++ LD D++  +  + I R  + E +  I G ++F    
Sbjct: 30  DAWYLLEYVTGITRAAYYAHPETELDADKEDAYFAH-IGRRARREPLQHITGEQEFMGYS 88

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKES----- 119
             +S     PR +TE+LV+ AL    P +      RILD+ TG+G V +++LK       
Sbjct: 89  FRVSGHVLIPRQDTEILVEEALKVLAPGM------RILDMCTGSGCVLISILKAGRERLR 142

Query: 120 -PFFKGVGVDISCKALEIAKSNAV-----------TNGVSERFDTLQSDWFSSVEGLFDV 167
               +G G DIS +A+ +A+ NA             NG   RF T   D F   E  +D+
Sbjct: 143 MERLEGTGSDISPEAVAVAEYNAARLLGRTETGRGNNGCCARFCT--GDLFEKAEERYDL 200

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI +  +  L  EVR  DP I+LDG  DGL  YR I    + ++ + G    EI
Sbjct: 201 IVSNPPYIRTEEIRKLQREVRLHDPYIALDGKKDGLYFYRRITAESAAYIAEGGYLMFEI 260

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
           G++Q  DV  + E      V   KD  G DR+
Sbjct: 261 GHDQAEDVCALLEQSGYADVFVKKDLAGLDRI 292


>gi|152970780|ref|YP_001335889.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150955629|gb|ABR77659.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 283

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   +VR  + E I  ++G R+F+++ 
Sbjct: 23  RDAEILLGYVTGRARTWILAFGETTLSADEAAKLEALLVRRQRGEPIAHLVGQREFWSLP 82

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 83  LFVSPATLIPRPDTECLVEQALA-RLPTAP----CRILDLGTGTGAIALALASERPDCEV 137

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA    ++      QSDWFS++ G  F  IVSNPPYI++      
Sbjct: 138 TAVDVMPDAVALALRNAEHLSIAN-VTISQSDWFSALAGQRFATIVSNPPYIDAADPHLA 196

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 197 EGDVR-FEPLTALVAGDQGLADLAHIIREGRQYLQPGGWMLLEHGWTQGEAVRALFREAG 255

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 256 YLDVATCRDYGDNERLTL 273


>gi|94264415|ref|ZP_01288205.1| Modification methylase HemK [delta proteobacterium MLMS-1]
 gi|93455172|gb|EAT05390.1| Modification methylase HemK [delta proteobacterium MLMS-1]
          Length = 319

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 122/222 (54%), Gaps = 8/222 (3%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIE--KRDVVRILDLGT 106
           E +  I+G  +F+++   +      PRPETELLV+ AL  + P++       + ILDLGT
Sbjct: 93  EPLAYIIGEWEFWSLPFAVDPGVLIPRPETELLVEEALRLA-PQLRGGAGRPLTILDLGT 151

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EG 163
           G+G + + L +E    + + VD S  AL +A+ N   + V  R   L +DW S++   + 
Sbjct: 152 GSGILAVVLARELAPARVIAVDRSPAALAVARRNVCRHRVESRVSLLAADWLSALAAGKA 211

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
           LFD++V+NPPY+E V +  L  EVRD++PR +LDGG  G++  R +A  +   L   G  
Sbjct: 212 LFDLVVANPPYVEDVALPGLEPEVRDYEPRQALDGGAAGMAQIRRLAAELPPFLRPGGGL 271

Query: 224 SVEIGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVLLFCR 264
            +EIG++Q+  V ++      +  V    D  G  R LL CR
Sbjct: 272 LMEIGWDQQGVVEQLLAPDNAWREVRILPDLAGLPR-LLCCR 312


>gi|120555271|ref|YP_959622.1| HemK family modification methylase [Marinobacter aquaeolei VT8]
 gi|120325120|gb|ABM19435.1| [protein release factor]-glutamine N5-methyltransferase
           [Marinobacter aquaeolei VT8]
          Length = 285

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 135/259 (52%), Gaps = 13/259 (5%)

Query: 6   DSHSFLCRVTGLS--SHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L  +TGL+  S +   + D  ++  +RFF    +      + +  +LG ++F+++
Sbjct: 29  DAELLLSHITGLTRTSFRAWPERDVPVEQAERFF--ELVGERASGQPVAYLLGEQEFWSL 86

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
            L +S  T  PRP TE +V++AL+  LP         +LDLGTGTGA+ LAL  E P ++
Sbjct: 87  PLKVSPSTLIPRPGTECVVEAALSLELPA-----RASVLDLGTGTGAIALALASEQPGWQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDC 182
            +  D    A+ +A+ N+ + G+      ++S WF  +  G FD+++SNPPYI +     
Sbjct: 142 VMASDRVEDAVALARENSQSLGLP--ITVVKSHWFDQIPAGTFDLLISNPPYIPASDRHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L  G DGL   R +       LN +G   +E GY+Q   V  +F   
Sbjct: 200 REGDVR-FEPESALVAGDDGLDDIRLLVTEGLNWLNPNGWMLLEHGYDQGSAVRDLFAKA 258

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   KDYGGNDR+ L
Sbjct: 259 GWRNMETRKDYGGNDRMTL 277


>gi|253688499|ref|YP_003017689.1| modification methylase, HemK family [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755077|gb|ACT13153.1| modification methylase, HemK family [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 281

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 136/258 (52%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L   ++  L   + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKRRTFLLAFGETALSAAEQQQLAELLARREQGEPIAYLIGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L++S  T  PRP+TE LV+ AL   LP+        +LDLGTGTGA+ LAL  E    + 
Sbjct: 82  LSVSPATLIPRPDTECLVEQAL-LRLPQ----KPCAVLDLGTGTGAIALALASERRDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
            GVD+   A+ +A  NA   G+ +    L   W+S ++   F +I SNPPYI++  +   
Sbjct: 137 TGVDVQPDAVALATKNAQQLGL-DNAHFLSGSWYSPLDQTRFALIASNPPYIDADDMHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  RTI +    +L   G   +E G+ Q   V ++ ++R 
Sbjct: 196 QGDVR-FEPASALIAADNGLADLRTIIESAPHYLAAGGWLLLEHGWQQADAVRQLLQARG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              +   +DYGGNDRV L
Sbjct: 255 FTQIETCQDYGGNDRVSL 272


>gi|330951101|gb|EGH51361.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae Cit 7]
          Length = 277

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WFS ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFSGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIREGFERIQTRRDLGEHERITFGCK 275


>gi|209516554|ref|ZP_03265408.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. H160]
 gi|209502995|gb|EEA02997.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. H160]
          Length = 295

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 131/260 (50%), Gaps = 19/260 (7%)

Query: 10  FLCRVTGLSSHQVIVDPDS--VLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTL 67
            L  V G    Q+I   +   +L D +R+    A  R +  E + +++G R+F+ +   +
Sbjct: 35  LLTHVLGWRRTQLITRGEEPLLLADVERYRALEA--RRVAGEPVAQLVGAREFFGLEFEV 92

Query: 68  SSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGV 127
           +     PRPETELLV++ALA     IE R   R+LDLGTGTGA+ +A+    P  +   +
Sbjct: 93  TPHVLIPRPETELLVETALAA----IEHRSRPRVLDLGTGTGAIAVAIASMRPDAQVWAL 148

Query: 128 DISCKALEIAKSN------AVTNGVSERFDTLQSDWFSSVEGL--FDVIVSNPPYIESVI 179
           D S  AL +A  N      A   G +  F  L SDW+ S++    FD IVSNPPYI S  
Sbjct: 149 DRSADALVVAARNGARLLDAKRPGGAVAF--LHSDWYGSLDAALRFDAIVSNPPYIASGD 206

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
                 ++R F+PR +L    DGLS  R I  G    L  DG   +E GY+Q   V  + 
Sbjct: 207 PHLSEGDLR-FEPRSALTDEADGLSAIRAIVAGAPERLATDGALWIEHGYDQAEAVRALL 265

Query: 240 ESRKLFLVNAFKDYGGNDRV 259
            +R    V + +D  G +R+
Sbjct: 266 SARGFAEVRSERDLAGIERI 285


>gi|302186443|ref|ZP_07263116.1| modification methylase HemK [Pseudomonas syringae pv. syringae 642]
          Length = 277

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 123/240 (51%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFASAQLLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRKRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WFS ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFSGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|262279541|ref|ZP_06057326.1| methyl transferase [Acinetobacter calcoaceticus RUH2202]
 gi|262259892|gb|EEY78625.1| methyl transferase [Acinetobacter calcoaceticus RUH2202]
          Length = 270

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 115/217 (52%), Gaps = 16/217 (7%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L+ +LP+        I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLSLNLPK-----NANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFD 166
           GA+ LAL  E P ++    DI    LE+AK NA T+G+ + +F      WF +++   FD
Sbjct: 118 GAIALALASEHPDWQVTATDIYAPTLEVAKENAQTHGLQQVKFAC--GAWFDALDKQQFD 175

Query: 167 VIVSNPPYI--ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCS 224
           +IVSNPPYI  E   +  L  E     PR +L     GL+    I       L   G  +
Sbjct: 176 LIVSNPPYIDPEDEHMQALATE-----PRRALVADHKGLADIEIIIAQGKNWLKPQGWIA 230

Query: 225 VEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           +E GY+Q   V  IF       +   +DYG NDRV L
Sbjct: 231 LEHGYDQGHAVRNIFAEHGFSQIKTIQDYGQNDRVTL 267


>gi|291560727|emb|CBL39527.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [butyrate-producing bacterium SSC/2]
          Length = 283

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 128/241 (53%), Gaps = 10/241 (4%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D + D          I +  +H  +  ILG ++F      ++ D   PR +TE +++  L
Sbjct: 47  DEINDKEAEERYKELIQKRKEHVPLQYILGTQEFMGYTFKVTPDVLIPRADTETVLEEVL 106

Query: 87  AFSLPRIEKRDVVRILDLGTGTG--AVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
              L + +K D   ILD+ TG+G  A+ LAL+ +      VG DIS KAL+IAK+N    
Sbjct: 107 D-QLKQSKKPDT--ILDICTGSGCIAISLALILKPEVC--VGTDISEKALKIAKANGENL 161

Query: 145 GVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
               +F  +QSD F +V G +D+I+SNPPYI +     L  EV+D++P ++LDG  DGL 
Sbjct: 162 APMVKF--IQSDLFENVTGSYDLIISNPPYITTEECGKLMPEVKDYEPMLALDGKEDGLY 219

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL-FC 263
            Y+ I      +LN  G+ + EIGY+Q   V  + E++    V   KD  G DR++  F 
Sbjct: 220 FYKKIIKEAKNYLNPQGMLAFEIGYDQGEAVKNLMEAQDFACVEIKKDLAGLDRLVFGFA 279

Query: 264 R 264
           R
Sbjct: 280 R 280


>gi|254429562|ref|ZP_05043269.1| methyltransferase, HemK family [Alcanivorax sp. DG881]
 gi|196195731|gb|EDX90690.1| methyltransferase, HemK family [Alcanivorax sp. DG881]
          Length = 275

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 125/257 (48%), Gaps = 8/257 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A  D+   LC V G     +   P+  L   Q+   T+ +   +  E +  ++G R+F+ 
Sbjct: 20  AALDAELLLCHVLGKPRSYLFTWPERELSTAQQADFTSLLGHRVAGEPVAHLIGEREFFG 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               +++DT  PRP+TE LV+ AL+  +P        R++DLGTGTGA+ ++L    P +
Sbjct: 80  HLFRVTADTLIPRPDTETLVEKALSLDVPA-----EARVVDLGTGTGAIGVSLALARPDW 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
               VD+S  AL++A  NA   G +     LQ  W S   G FD+IVSNPPYIE      
Sbjct: 135 HVTLVDLSEAALQVAADNAHRLGAA--VTCLQGSWLSPCPGPFDLIVSNPPYIEESDHHL 192

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+PR +L    +GL+    I    +  L   G   +E G+ Q   V  +    
Sbjct: 193 DEGDVR-FEPRSALVAPNNGLADLAAITQQAAGKLVAGGWLLLEHGFEQGEAVRTLLTQA 251

Query: 243 KLFLVNAFKDYGGNDRV 259
               V   +D GGNDRV
Sbjct: 252 GFVQVGTAQDLGGNDRV 268


>gi|94271211|ref|ZP_01291906.1| Modification methylase HemK [delta proteobacterium MLMS-1]
 gi|93450531|gb|EAT01681.1| Modification methylase HemK [delta proteobacterium MLMS-1]
          Length = 325

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 122/222 (54%), Gaps = 8/222 (3%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIE--KRDVVRILDLGT 106
           E +  I+G  +F+++   +      PRPETELLV+ AL  + P++       + ILDLGT
Sbjct: 93  EPLAYIIGEWEFWSLPFAVDPGVLIPRPETELLVEEALRLA-PQLRGGAGRPLTILDLGT 151

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EG 163
           G+G + + L +E    + + VD S  AL +A+ N   + V  R   L +DW S++   + 
Sbjct: 152 GSGILAVVLARELAPARVIAVDRSPAALAVARRNVCRHRVESRVSLLAADWLSALAAGKA 211

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
           LFD++V+NPPY+E V +  L  EVRD++PR +LDGG  G++  R +A  +   L   G  
Sbjct: 212 LFDLVVANPPYVEDVALPGLEPEVRDYEPRQALDGGAAGMAQIRRLAAELPPFLRPGGGL 271

Query: 224 SVEIGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVLLFCR 264
            +EIG++Q+  V ++      +  V    D  G  R LL CR
Sbjct: 272 LMEIGWDQQGVVEQLLAPDNAWREVRILPDLAGLPR-LLRCR 312


>gi|294650078|ref|ZP_06727462.1| protein-glutamine N-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292824029|gb|EFF82848.1| protein-glutamine N-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 273

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 137/264 (51%), Gaps = 15/264 (5%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +++   L  + G++S ++ +  +  L + Q     + + R  + E +  + G + F+ + 
Sbjct: 19  QEAAWLLEHILGVNSLELKLRLEQELTEIQEQAYLDGLARIEQGEPLAYVTGSQPFWTLD 78

Query: 65  LTLSSDTFEPRPETELLVDSALAFSL-PRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PRP+TE+LV++ L  SL P+        I+DLGTGTGA+ LAL  E P + 
Sbjct: 79  LKVTHDTLVPRPDTEILVETVLKLSLDPQ------ANIVDLGTGTGAIALALASERPQWS 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVS-ERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIV 180
               DI    L++A+ NA+ +G+S  +F      WF ++  +  FD+IVSNPPYI+    
Sbjct: 133 VTATDIYQPTLDVAQDNALKHGLSLVKFAC--GAWFEALVEQQQFDLIVSNPPYIDP--- 187

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           D + ++    +P  +L     GL+    I       L   G  ++E GY+Q+  V  IFE
Sbjct: 188 DDVHMQKLKSEPERALIAANHGLADIEIIIAQGKAWLKAKGWIALEHGYDQRQAVREIFE 247

Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264
                 +   KDYGGNDRV L  +
Sbjct: 248 LHGFEQIQTIKDYGGNDRVSLAQK 271


>gi|20806671|ref|NP_621842.1| rRNA or tRNA methylase [Thermoanaerobacter tengcongensis MB4]
 gi|20515121|gb|AAM23446.1| predicted rRNA or tRNA methylase [Thermoanaerobacter tengcongensis
           MB4]
          Length = 285

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 130/243 (53%), Gaps = 9/243 (3%)

Query: 21  QVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETEL 80
           ++ +  D VL + +       I +         I+  + F      +      PRPETE+
Sbjct: 45  KLAIKRDEVLKEEELERFLKYIEKRKSRIPYQYIVKKQHFMGFEFYVDERVLIPRPETEI 104

Query: 81  LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN 140
           LV+ AL     R++  D+  ILD+GTG+GA+ +++ K  P  K   VD+S +ALE+AK N
Sbjct: 105 LVEEALK----RMKSGDL--ILDIGTGSGAIAISIAKLFPDCKVYAVDVSEEALEVAKYN 158

Query: 141 AVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDG 198
           A   GV+E+   ++SD FS++     FD+IVSNPPYI+   ++ L  EV+  +P ++LDG
Sbjct: 159 AEKLGVAEKIIFIKSDIFSNIPQDVKFDLIVSNPPYIKKAELENLQEEVKK-EPILALDG 217

Query: 199 GIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           G DGL  Y+ I      +L K G    EIGY Q+ +V +IF       +   KD    DR
Sbjct: 218 GEDGLFFYKRIIPDCKFYLKKGGRGLFEIGYGQREEVEKIFLENGFDEIEVIKDLAHIDR 277

Query: 259 VLL 261
           V++
Sbjct: 278 VII 280


>gi|325263709|ref|ZP_08130442.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium sp. D5]
 gi|324030747|gb|EGB92029.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium sp. D5]
          Length = 306

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 133/278 (47%), Gaps = 25/278 (8%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V+G+        PD +L + Q    T+ I R  +   +  + G ++F  +  
Sbjct: 25  DAWYLLEYVSGVGRAMYYAMPDKLLTEAQEKQYTDYIERRAQRIPLQHLTGTQEFMGLEF 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEK------------------RDVVRILDLGTG 107
            ++     PR +TE+LV+ AL  +   +E                   R   R+LD+ TG
Sbjct: 85  QVNEHVLIPRQDTEVLVEEALGAAEKYMEHMSCSFAGNRGAGDGCEDARKTFRLLDMCTG 144

Query: 108 TGAVCLALL-----KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE 162
           +G + L++L      +    KG+GVD+S KALE A++NA  + +    D L SD F  VE
Sbjct: 145 SGCILLSMLHYISKNKQMQSKGLGVDVSEKALETARANA--DALHIDADFLHSDLFEQVE 202

Query: 163 GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
           G F +IVSNPPYI + +++ L  EV+  DP ++LDG  DGL  YR I       L   G 
Sbjct: 203 GSFQMIVSNPPYIRTDVIETLQEEVKGHDPVLALDGRADGLYFYRKIVREAKHCLVSGGS 262

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
              EIG +Q   V  +        V+  KD  G DRV+
Sbjct: 263 LLFEIGADQGEAVSAMMWEAGYSRVSVKKDLAGLDRVV 300


>gi|91792281|ref|YP_561932.1| HemK family modification methylase [Shewanella denitrificans OS217]
 gi|91714283|gb|ABE54209.1| modification methylase, HemK family [Shewanella denitrificans
           OS217]
          Length = 284

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 10/238 (4%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+  L  +Q     N +++  +   +  I+G R+F+++   ++  T  PRP+TE+LV++A
Sbjct: 50  PEKALSVQQFRAFNNMVLKRQQGVPVAHIIGEREFWSLPFIVNESTLIPRPDTEILVETA 109

Query: 86  LAFSL-PRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
           L  +L P        ++LDLGTGTGA+ L+L  E P +K   +D   +A+E+AK+N   N
Sbjct: 110 LNLTLSPH------AKVLDLGTGTGAIALSLASERPDWKVTAIDKVDEAVELAKANR-QN 162

Query: 145 GVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGL 203
               + + LQSDWFS+V+   FD+IVSNPPYI++   + L L    F+P+ +L  G  G 
Sbjct: 163 LNLPQVEILQSDWFSAVKDRDFDLIVSNPPYIDAED-EHLNLGDVRFEPQSALTAGEHGY 221

Query: 204 SHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           +    IA+    HL   G   +E G+ Q + V           V   +D+G NDR  L
Sbjct: 222 ADLFHIAEHAREHLVHGGYLLLEHGFEQAIKVREKLIELGYQQVATVRDFGSNDRCTL 279


>gi|289678405|ref|ZP_06499295.1| modification methylase HemK [Pseudomonas syringae pv. syringae FF5]
          Length = 277

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WF  ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFGGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGAAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|218549097|ref|YP_002382888.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|218356638|emb|CAQ89264.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Escherichia fergusonii ATCC 35469]
 gi|325497512|gb|EGC95371.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia fergusonii ECD227]
          Length = 276

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 130/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E +  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGRGRTFILAFGETQLTDEQLQQLDALLARRRAGEPVAHLTGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALE-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA    + +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVALAQRNAQHLAI-KNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L  G  G++    I +     L K G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAGDHGMADIVHIIEHSRAALAKGGYLLLEHGWQQGAAVRQAFIQAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGN+R+ L
Sbjct: 255 YSNVETCRDYGGNERITL 272


>gi|213967223|ref|ZP_03395372.1| hemK protein [Pseudomonas syringae pv. tomato T1]
 gi|301381041|ref|ZP_07229459.1| hemK protein [Pseudomonas syringae pv. tomato Max13]
 gi|302060377|ref|ZP_07251918.1| hemK protein [Pseudomonas syringae pv. tomato K40]
 gi|302134867|ref|ZP_07260857.1| hemK protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213928065|gb|EEB61611.1| hemK protein [Pseudomonas syringae pv. tomato T1]
 gi|331018121|gb|EGH98177.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 277

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 120/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGRQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGADGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HLN DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAQAHLNADGWLLLEHGYDQGPAVRELLTRHGFERIQTRRDLGEHERITFGCK 275


>gi|261409697|ref|YP_003245938.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus sp. Y412MC10]
 gi|261286160|gb|ACX68131.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Paenibacillus sp. Y412MC10]
          Length = 296

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 132/267 (49%), Gaps = 11/267 (4%)

Query: 1   MQALRDSHSFLCRVTGLSS---HQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGW 57
           M+  R++   L  V GLS    +  + DP     + +R  L  AI R  +      I+G 
Sbjct: 31  MEPQRNAQLLLEHVLGLSGTSYYMALTDP---FPEGRRLALEEAITRKAEGVPAQYIIGE 87

Query: 58  RDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALL 116
           ++FY     ++     PRPETELLV++ L +      + D  ++++D+GTG+GA+ + L 
Sbjct: 88  QEFYGRPFDVTPAVLIPRPETELLVEAVLKYGQELTPQPDGGLKVVDIGTGSGAIAITLA 147

Query: 117 KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYI 175
            +S  +     DIS  ALE+A  NA   G    F   Q +      G+  D++VSNPPYI
Sbjct: 148 LQSKGWDVFASDISPDALEVAARNAKKLGAQVEFR--QGNLLEPFAGMGPDILVSNPPYI 205

Query: 176 ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDV 235
            +  ++ L  EVRD++PR +LDGG DGL+ YR +   +        L + E+G  Q  DV
Sbjct: 206 PAEDIEELQPEVRDYEPRTALDGGPDGLNPYRIMMAQLPFLSAPPRLIAFELGMGQAGDV 265

Query: 236 VRIFESRKLF-LVNAFKDYGGNDRVLL 261
             +      +  +    D  G DR +L
Sbjct: 266 AELLRKAGYWEEIVTVPDLAGIDRHVL 292


>gi|167038491|ref|YP_001666069.1| HemK family modification methylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167038766|ref|YP_001661751.1| HemK family modification methylase [Thermoanaerobacter sp. X514]
 gi|256751360|ref|ZP_05492239.1| modification methylase, HemK family [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913649|ref|ZP_07130966.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter sp. X561]
 gi|307723336|ref|YP_003903087.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter sp. X513]
 gi|320116887|ref|YP_004187046.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166853006|gb|ABY91415.1| modification methylase, HemK family [Thermoanaerobacter sp. X514]
 gi|166857325|gb|ABY95733.1| modification methylase, HemK family [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256749742|gb|EEU62767.1| modification methylase, HemK family [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890334|gb|EFK85479.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter sp. X561]
 gi|307580397|gb|ADN53796.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter sp. X513]
 gi|319929978|gb|ADV80663.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 279

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 121/216 (56%), Gaps = 9/216 (4%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H     I+    F  +   +  +   PRPETE+LV+  L     R++K +   ++D+GTG
Sbjct: 66  HIPYQYIVKKHYFMGLEFFVDENVLIPRPETEILVEEVLK----RLKKGNT--LIDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LF 165
           +GA+ ++++K  P      VDIS KALE+AK NA  + V ++   ++SD FS V     F
Sbjct: 120 SGAIAVSVVKYFPDCFVYAVDISRKALEVAKYNAKKHNVLDKIVFIESDVFSQVPKNIKF 179

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D IVSNPPYI+   ++ L  EV+  +P I+LDGG DGL  Y+ I +G   +LN +G    
Sbjct: 180 DFIVSNPPYIKRGELETLQEEVKK-EPIIALDGGEDGLFFYKKIIEGAPFYLNPEGAICF 238

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           E+GY+QK +V  +        +   KD  G DRV++
Sbjct: 239 EMGYDQKEEVTDLLTKGGFKNIEVIKDLSGIDRVVI 274


>gi|183598964|ref|ZP_02960457.1| hypothetical protein PROSTU_02408 [Providencia stuartii ATCC 25827]
 gi|188021180|gb|EDU59220.1| hypothetical protein PROSTU_02408 [Providencia stuartii ATCC 25827]
          Length = 281

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 133/260 (51%), Gaps = 8/260 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L  +TG S   +    ++ L   +   L + + R  + E I  I+G R+F++
Sbjct: 20  AKRDAEILLQHITGRSRTFIFAFAETELTQPEYEALESLLCRREQGEPIAYIIGEREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L +S  T  PRP+TE LV+ ALA  LP        +ILDLGTGTGA+ LA+  E P  
Sbjct: 80  LPLFVSPATLIPRPDTECLVEQALA-RLP----AQRCQILDLGTGTGAIALAIASERPDS 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVD 181
             +G+D +  A+ +A+ N     ++     LQSDWF+S+    FD+IVSNPPYI+     
Sbjct: 135 VIIGIDFNLDAVSLAQRNQQRLALN-NVQFLQSDWFTSLSCQHFDMIVSNPPYIDGNDDH 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L     GLS    I      +LN  G   VE G+ Q   V  +F+ 
Sbjct: 194 LQQGDVR-FEPLTALVADNHGLSDLDHIVSTSRSYLNPQGWLLVEHGWQQGAAVRELFKQ 252

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +    DYGG DR+ L
Sbjct: 253 YGYSNIETCLDYGGRDRISL 272


>gi|332993698|gb|AEF03753.1| peptide release factor-glutamine N5-methyltransferase [Alteromonas
           sp. SN2]
          Length = 288

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 118/217 (54%), Gaps = 13/217 (5%)

Query: 51  IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA------FSLPRIEKRDVVRILDL 104
           +  + G RDF+ +RL  S  T  PRP+TE+LV+  L+      F+L  +E   +  I DL
Sbjct: 68  VAYLTGSRDFWTLRLATSPHTLIPRPDTEVLVEQTLSCIASAEFAL-EVEDNKLA-ICDL 125

Query: 105 GTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG 163
           GTGTGA+ LAL  E P     GVD+  +A+++A SNA  N ++  +F   QS WF ++  
Sbjct: 126 GTGTGAIALALASELPTANITGVDLLHEAVQLATSNAALNSITNAQFK--QSSWFDNLAN 183

Query: 164 -LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGL 222
             F VIVSNPPYIE         +VR F+P  +L  G DGL   + I      HL + GL
Sbjct: 184 EKFHVIVSNPPYIEISSPFLQQGDVR-FEPASALTSGADGLDDIKHIIALAPAHLLEGGL 242

Query: 223 CSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
            + E G++Q   V  +  +     V   KDYGGNDRV
Sbjct: 243 LAFEHGFDQAKAVGDLLNAHGFVNVCTEKDYGGNDRV 279


>gi|134294602|ref|YP_001118337.1| HemK family modification methylase [Burkholderia vietnamiensis G4]
 gi|134137759|gb|ABO53502.1| [protein release factor]-glutamine N5-methyltransferase
           [Burkholderia vietnamiensis G4]
          Length = 280

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 127/260 (48%), Gaps = 11/260 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G +  Q+I   D+ L+            R +  E + +++G R+F+    
Sbjct: 19  DARVLLSHALGWTRTQLITRGDAPLEPAAIARYRALEARRVAGEPVAQLVGMREFFGRPF 78

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++ D   PRPETELLV++AL      I+ R    +LDLGTG+GA+ +++  E P  +  
Sbjct: 79  DVTPDVLIPRPETELLVEAALDA----IDGRPHPAVLDLGTGSGAIAVSIAAERPDARVW 134

Query: 126 GVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIESVI 179
            +D S  ALE+A+ NA     + R       LQSDW+++++    FD IVSNPPYI    
Sbjct: 135 ALDRSPAALEVAQRNAAKLLDARRPGGPLHWLQSDWYAALDPALAFDAIVSNPPYIAQHD 194

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
                 ++R F+PR +L    DGLS  RTI  G   HL   G   +E GY+Q   V  + 
Sbjct: 195 PHLEQGDLR-FEPRGALTDDADGLSAIRTIVAGAGAHLKPGGTLWIEHGYDQAEAVRALL 253

Query: 240 ESRKLFLVNAFKDYGGNDRV 259
            S     V +  D    +R 
Sbjct: 254 ASHGFVAVESLADLAAIERT 273


>gi|330887863|gb|EGH20524.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. mori str. 301020]
          Length = 277

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++        T  + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFTGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|238019081|ref|ZP_04599507.1| hypothetical protein VEIDISOL_00943 [Veillonella dispar ATCC 17748]
 gi|237864336|gb|EEP65626.1| hypothetical protein VEIDISOL_00943 [Veillonella dispar ATCC 17748]
          Length = 289

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 121/218 (55%), Gaps = 9/218 (4%)

Query: 47  KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGT 106
           K   +  I+G +DF  +   ++     PRP+TE L++  L  + P+  K   VRILD+ T
Sbjct: 71  KGHCVAAIIGEKDFMGLTFKVNDKVLIPRPDTETLIEHVLG-AYPKDSK---VRILDVCT 126

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--- 163
           G G + L+LL   P   GVG++IS  AL +A+ N     +++R   L+SD FS+++G   
Sbjct: 127 GPGTILLSLLHYLPNACGVGLEISTDALTVAEENRERFNLNDRVQLLESDMFSALDGKAE 186

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI +     L  +V + +P I+L GG DGL  YR +A     +L   G  
Sbjct: 187 KFDLIVSNPPYIRTGDAKLLSQDVLN-EPHIALFGGEDGLEFYRILAKACGTYLKPQGRI 245

Query: 224 SVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           + EIGY+Q  +V  +  E+     +    D GGN+RV+
Sbjct: 246 AFEIGYDQAEEVKSLLKEAGHYSNIQCIADLGGNNRVV 283


>gi|330967415|gb|EGH67675.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 277

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGRQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI    S HLN DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADASAHLNADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|330873306|gb|EGH07455.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 277

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++S T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVASHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGRQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HLN DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPAHLNADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|254246466|ref|ZP_04939787.1| Methylase [Burkholderia cenocepacia PC184]
 gi|124871242|gb|EAY62958.1| Methylase [Burkholderia cenocepacia PC184]
          Length = 280

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 131/262 (50%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L    G +  Q+I   D+ LDD   +R+    A  R +  E + +++G R+F+  
Sbjct: 19  DARVLLAHALGWTRTQLITRGDAPLDDAAVERYRALEA--RRVAGEPVAQLVGMREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ D   PRPETELLV++AL      I+      +LDLGTG+GA+ +++  E P  +
Sbjct: 77  PFDVTPDVLIPRPETELLVEAALDA----IDGLPHAAVLDLGTGSGAIAVSIAAERPDAR 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S  AL +A+ NA     + R       LQSDW+++++    FD IVSNPPYI  
Sbjct: 133 VWALDRSPAALAVAQRNADKLLDARRPGGPLHWLQSDWYAALDPALGFDAIVSNPPYIAQ 192

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L  G DGLS  RTI  G   +L   G   +E GY+Q   V  
Sbjct: 193 HDPHLAQGDLR-FEPRGALTDGADGLSAIRTIVAGAGAYLKPGGTLWIEHGYDQAEAVRA 251

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           I  S     V +  D    +R 
Sbjct: 252 ILASHGFVAVESLADLTAIERT 273


>gi|28868325|ref|NP_790944.1| hemK protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28851562|gb|AAO54639.1| hemK protein [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 277

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 120/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DYAQVLNSHWFSALEGRQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGADGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HLN DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAQAHLNADGWLLLEHGYDQGPAVRELLTRHGFERIQTRRDLGEHERITFGCK 275


>gi|121727186|ref|ZP_01680353.1| hemK protein [Vibrio cholerae V52]
 gi|147674049|ref|YP_001217694.1| hemK protein [Vibrio cholerae O395]
 gi|262167527|ref|ZP_06035233.1| Polypeptide chain release factor methylase [Vibrio cholerae RC27]
 gi|121630431|gb|EAX62824.1| hemK protein [Vibrio cholerae V52]
 gi|146315932|gb|ABQ20471.1| hemK protein [Vibrio cholerae O395]
 gi|227014074|gb|ACP10284.1| hemK protein [Vibrio cholerae O395]
 gi|262024099|gb|EEY42794.1| Polypeptide chain release factor methylase [Vibrio cholerae RC27]
          Length = 286

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 129/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +       Q  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFFQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L  DG    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDDGWLLFEHGYDQGVAVRTIMSD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIMTEQDYAGHDRVTL 277


>gi|126665162|ref|ZP_01736145.1| Modification methylase HemK [Marinobacter sp. ELB17]
 gi|126630532|gb|EBA01147.1| Modification methylase HemK [Marinobacter sp. ELB17]
          Length = 314

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 87/281 (30%), Positives = 131/281 (46%), Gaps = 33/281 (11%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L +VTG S  +    P+  +   Q       + +    E +  +LGW++F+++ L
Sbjct: 38  DAELLLVQVTGWSRTRFRAFPEQHVSLVQAAAFEQLVDKRAAGEPVAYVLGWQEFWSLPL 97

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S+ T  PRP+TE +V+ AL   LP        R+LDLGTGTGA+ LAL  E P +   
Sbjct: 98  QVSAATLIPRPDTECVVEQALTLDLPA-----QARVLDLGTGTGAIALALASERPDWDIT 152

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL--------------------- 164
             D    A+ +A+SNA    ++     ++S WF  +  +                     
Sbjct: 153 ASDFVDAAVALAQSNAA--ALNLPIQVVKSHWFDQLTAVCFDQRLDESGDPRRDLRGDLN 210

Query: 165 ----FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
               FD+IVSNPPYI +        +VR F+P  +L  G DGL   R I       LN  
Sbjct: 211 RDQGFDLIVSNPPYIANTDHHLSEGDVR-FEPASALVSGADGLDDIRHIVAAAPSWLNAG 269

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E GY+Q   V  +   +    V++ +DYG NDR+ L
Sbjct: 270 GWLLLEHGYDQAQAVQGLLHQQGFDQVHSRQDYGRNDRMTL 310


>gi|330975578|gb|EGH75644.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 277

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WF  ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFGGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|330972815|gb|EGH72881.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 277

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 123/240 (51%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WFS ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFSGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|296111566|ref|YP_003621948.1| protoporphyrinogen oxidase (putative) [Leuconostoc kimchii IMSNU
           11154]
 gi|295833098|gb|ADG40979.1| protoporphyrinogen oxidase (putative) [Leuconostoc kimchii IMSNU
           11154]
          Length = 331

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 120/221 (54%), Gaps = 5/221 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I + L ++ +  ILG   FY     +      PRPETE LV+  L     +I +   + +
Sbjct: 110 IAKLLANQPVQYILGHAPFYGREFIVDERVLIPRPETEQLVEWILKDVSSQIAQP--ISV 167

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+GTG+GA+   L+ E+   +G   DIS  AL +A+ NA   G+      ++SD +S+V
Sbjct: 168 LDIGTGSGAIIETLMLENSDIRGFAADISSDALAVAELNAQRLGL-HYLHVIESDVYSAV 226

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            GL FDVIVSNPPYI S   D + + V +F+PR +L    DGL+ Y  +A+ +  HL + 
Sbjct: 227 AGLKFDVIVSNPPYIASTDEDEMDISVLNFEPRTALFAEHDGLAIYELLAEKLDAHLTEH 286

Query: 221 GLCSVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           G    EIGY Q   VV I  ++     +   +D+ G DR++
Sbjct: 287 GRAYFEIGYKQGQQVVDIMQQALPQAKITLRQDFAGLDRMI 327


>gi|229828876|ref|ZP_04454945.1| hypothetical protein GCWU000342_00961 [Shuttleworthia satelles DSM
           14600]
 gi|229792039|gb|EEP28153.1| hypothetical protein GCWU000342_00961 [Shuttleworthia satelles DSM
           14600]
          Length = 284

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 125/233 (53%), Gaps = 17/233 (7%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL----AFSLPRIEKRD 97
           I R  +   + +I G + F  +   ++     PR +TE LV+  L    +     ++ R 
Sbjct: 48  IERRAQRIPLQQITGSQAFMGLDFMVNEHVLCPRQDTETLVEEGLTILASLQSGSVKNRQ 107

Query: 98  V-----VRILDLGTGTGAVCLALL-----KESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
                 +R+LDL TG+G + ++LL     +E+P   G+  D+S +AL +A+ NA  NGVS
Sbjct: 108 ANADREIRLLDLCTGSGCILISLLALARGQETPI-HGLAADLSPEALAVARENAKRNGVS 166

Query: 148 ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
             F  + SD F+ +EG FD+I +NPPYI S  ++ L  EVRD +PR++LDG  DGL+ YR
Sbjct: 167 AAF--VLSDLFAEIEGSFDLITANPPYIPSGQLEDLMPEVRDHEPRMALDGDEDGLAFYR 224

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            IA     +L + G   +EI ++Q   V ++        +   +D  G DRVL
Sbjct: 225 RIAGQAPDYLREGGWLLMEIAFDQGQAVRQMLADGPFEEIEIIQDLSGRDRVL 277


>gi|145588323|ref|YP_001154920.1| HemK family modification methylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046729|gb|ABP33356.1| [protein release factor]-glutamine N5-methyltransferase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 283

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 3/219 (1%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           + L  E I  ++G R F+N+ L ++     PR ETELLVD  L       + + +V++LD
Sbjct: 62  KRLDGEPIAYLIGKRGFHNIELQVAPGVLIPRAETELLVDIGLKEIARLTDNQKMVKVLD 121

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG 163
           LGTG+GA+ LAL  E+        D S  AL IA+SNA    +  R    Q +W+ ++  
Sbjct: 122 LGTGSGAIALALTHEASNISVTATDQSLDALAIARSNAHYLELENRVCFAQGNWYEAISK 181

Query: 164 --LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDG 221
             +FD+I+SNPPYI +        ++R F+P  +L     GL+   TI  G   HLN +G
Sbjct: 182 NDVFDIILSNPPYIANHDPHLTQGDLR-FEPLSALTDHSTGLTCLETIIFGAKAHLNTEG 240

Query: 222 LCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           L +VE G++Q   VV +  + +L  +    D  G++RV+
Sbjct: 241 LLAVEHGFDQSEAVVELMRTAQLKDIQIHLDLAGHNRVV 279


>gi|260438935|ref|ZP_05792751.1| protein-(glutamine-N5) methyltransferase [Butyrivibrio crossotus
           DSM 2876]
 gi|292808586|gb|EFF67791.1| protein-(glutamine-N5) methyltransferase [Butyrivibrio crossotus
           DSM 2876]
          Length = 276

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 140/261 (53%), Gaps = 12/261 (4%)

Query: 2   QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFY 61
           +A  D+        G++    ++D ++  +     F  + I + L H  +  ILG   F 
Sbjct: 21  EAGNDAWLLFSEAFGMTRTDYLIDKNAECNAGHIPFFDSCIEKRLAHIPVQYILGKAYFM 80

Query: 62  NVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG--AVCLALLKES 119
                ++++   PR +TE+LV   L ++      +D  +ILD+ TG+G  A+ L+LL  +
Sbjct: 81  GYEFEVNNNVLIPRFDTEVLVSEVLKYT------QDDFKILDMCTGSGCIAISLSLLSGA 134

Query: 120 PFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVI 179
                 GVDIS KAL +A  N V N  +++   ++S+ F +++G F++IVSNPPYI +  
Sbjct: 135 EV---TGVDISEKALAVADYNKVINK-ADKVTFVKSNMFENIDGAFNLIVSNPPYIPTKD 190

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           +  L  EV++ +P ++L+G  DGL  YR +A+  +++L  +G   +EIGYNQ  DV  + 
Sbjct: 191 IFELEHEVKNEEPMLALNGHDDGLFFYRILAEESAKYLRHNGGIFMEIGYNQAEDVRNLL 250

Query: 240 ESRKLFLVNAFKDYGGNDRVL 260
                  ++  KD  G DRV+
Sbjct: 251 IKNNFTDISVIKDLAGLDRVV 271


>gi|218961885|ref|YP_001741660.1| modification methylase, HemK family [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730542|emb|CAO81454.1| modification methylase, HemK family [Candidatus Cloacamonas
           acidaminovorans]
          Length = 273

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 121/248 (48%), Gaps = 8/248 (3%)

Query: 17  LSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRP 76
           LS  ++I+    +L D +   + NA  R  K E    I G   FY + L ++     PRP
Sbjct: 34  LSRSEIILSRQRILTDWEGEIIGNAFSRLEKGEPPQYITGTAYFYGLDLKVNPAVLIPRP 93

Query: 77  ETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEI 136
           ETE LV+     ++ R+  +   RILD+GTG+GA+ +AL    P       +IS  ALE 
Sbjct: 94  ETERLVE----LTMERL--KGTERILDIGTGSGAIAIALKHNLPSLNVSATEISFSALET 147

Query: 137 AKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISL 196
           AK NA        F    SD F  V+  ++V++SNPPYI    +  L   ++D +P I+L
Sbjct: 148 AKKNAEIYRADIHF--YLSDCFPPVKQSYEVLISNPPYISKAEIATLNSRIKDKEPVIAL 205

Query: 197 DGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGN 256
            GG DGL  YR +    S +L+++G  ++E    QK  ++ I        +   KD    
Sbjct: 206 QGGEDGLDFYRKLLSESSEYLSENGFLALEHSDTQKEAIMNIARKEGWTKIEPLKDLTDK 265

Query: 257 DRVLLFCR 264
           DR L   R
Sbjct: 266 DRYLFIYR 273


>gi|90412791|ref|ZP_01220791.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Photobacterium profundum 3TCK]
 gi|90326150|gb|EAS42577.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Photobacterium profundum 3TCK]
          Length = 282

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 133/261 (50%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  P+    D Q       + R +  E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLDKPRSYLLTWPEKEPSDEQFTLFEALLARRITGEPVAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL   +P         +LDLGTGTGA+ LA+  E    +  
Sbjct: 87  KVSPFTLIPRPDTERLVEVALE-KIP----TQACTVLDLGTGTGAIALAIASERNDAQVT 141

Query: 126 GVDISCKALEIAKSNAV-TNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDC 182
           G+D+  +A E+A  N    N  + RF  L   W++ +  + LF VIVSNPPYI++     
Sbjct: 142 GIDLRPEAAELAAENGQRLNIQNARF--LAGSWYTPLASDELFAVIVSNPPYIDAADPHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +  +VR F+P+ +L    +GL+  + I++   +HL   G   +E G+ Q   V  I +  
Sbjct: 200 VLGDVR-FEPKTALIADDNGLADIQIISEQGRQHLQTGGWLLMEHGFEQGEAVRHILQEL 258

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
              LV+  +DY G DRV L C
Sbjct: 259 GYHLVSTAQDYAGLDRVTLGC 279


>gi|66044203|ref|YP_234044.1| modification methylase HemK [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254910|gb|AAY36006.1| Modification methylase HemK [Pseudomonas syringae pv. syringae
           B728a]
          Length = 277

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 123/240 (51%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  +   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WFS ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFSGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|148266071|ref|YP_001232777.1| HemK family modification methylase [Geobacter uraniireducens Rf4]
 gi|146399571|gb|ABQ28204.1| [protein release factor]-glutamine N5-methyltransferase [Geobacter
           uraniireducens Rf4]
          Length = 284

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 88/256 (34%), Positives = 126/256 (49%), Gaps = 9/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   LC V GL    + V+ D  L + +       + R  K E +  ILG ++F  +  
Sbjct: 32  ESEWMLCAVLGLDRVGLYVNFDKPLTEAELSGYRGMVTRRSKREPLQYILGSQEFMGLEF 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S     PR +TE+LV  A A         +  RILD+G G+G V +AL K  P    +
Sbjct: 92  EVSPAVLIPRHDTEVLVAEAAA------RCGEHCRILDIGVGSGCVSVALAKALPTATIL 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
           GVD S +AL +A+ NA   GV+      +   F   +   FD+IVSNPPYI +  +  L 
Sbjct: 146 GVDSSPQALVLAQKNADKQGVT--VSLFEGSLFEPFQDQRFDLIVSNPPYIPTDDLKTLQ 203

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVRD++P  +LDGG DGL  YR I    S +LN  G    E+G  Q   V+ + +    
Sbjct: 204 PEVRDYEPIQALDGGADGLDFYRLIVPAASDYLNPGGWLLFEVGVGQAEAVLGLLDKTGF 263

Query: 245 FLVNAFKDYGGNDRVL 260
             +   KD  G +RV+
Sbjct: 264 GELFTAKDPNGIERVV 279


>gi|330899754|gb|EGH31173.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 277

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFASAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WF  ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EVFESHWFGGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNADGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|294670647|ref|ZP_06735523.1| hypothetical protein NEIELOOT_02370 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307617|gb|EFE48860.1| hypothetical protein NEIELOOT_02370 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 271

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 126/260 (48%), Gaps = 17/260 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L  VTG +  Q+I     +LD+ Q   L     R L  E +  ILGWR+FY  R 
Sbjct: 16  EARMLLQAVTGWTRAQLITRDGEMLDEGQTADLQAMQQRRLNGEPMAYILGWREFYGRRF 75

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
             +  T  PRPETE LV++AL    P+        + DLGTG+GAV + L  E P    +
Sbjct: 76  RTTPATLIPRPETEHLVEAALQHLPPQ------GLVWDLGTGSGAVAVTLACERPDASVL 129

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWF----SSVEGLFDVIVSNPPYIESVIVD 181
             DIS  AL +A+ NA  NG    F      WF     S +  FD++VSNPPYIE+   D
Sbjct: 130 ASDISPAALAVARQNAADNGADVSFAC--GSWFDIDRPSEKHGFDLLVSNPPYIEA---D 184

Query: 182 CLGLEVRD--FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
              L+  D  F+P  +L    DGLS  R +A   + +L   G   +E G+NQ   V +I 
Sbjct: 185 DGHLQQGDLRFEPANALTDFSDGLSCIRELAAHGAEYLKPGGRLIMEHGWNQGAAVRQIL 244

Query: 240 ESRKLFLVNAFKDYGGNDRV 259
            +     +    D  G +R+
Sbjct: 245 AAAGWTEIETQTDLAGLERI 264


>gi|54309993|ref|YP_131013.1| putative HemK protein, methylase of polypeptide chain release
           factors [Photobacterium profundum SS9]
 gi|46914432|emb|CAG21211.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Photobacterium profundum SS9]
          Length = 282

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 86/261 (32%), Positives = 132/261 (50%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  P+    D Q       + R +  E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLDKPRSYLLTWPEKAPSDEQFTLFEALLARRITGEPVAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL   +P         +LDLGTGTGA+ LA+  E    +  
Sbjct: 87  KVSPFTLIPRPDTERLVELALE-KIP----TQACTVLDLGTGTGAIALAIASERNDAQVT 141

Query: 126 GVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDC 182
           G+D+  +A E+A  N     +   RF  L   W++ +  + LF VIVSNPPYI++     
Sbjct: 142 GIDLRPEAAELAAENGQRLNIQNVRF--LAGSWYTPLASDELFSVIVSNPPYIDAADPHL 199

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +  +VR F+P+ +L    +GL+  + I++   +HL   G   +E G+ Q   V  I +  
Sbjct: 200 VLGDVR-FEPKTALVADDNGLADIQIISEQGRQHLQTGGWLLMEHGFEQGEAVRHILQEL 258

Query: 243 KLFLVNAFKDYGGNDRVLLFC 263
              LV+  +DY G DRV L C
Sbjct: 259 GYHLVSTAQDYAGLDRVTLGC 279


>gi|40062642|gb|AAR37563.1| modification methylase, HemK family [uncultured marine bacterium
           313]
          Length = 279

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 140/267 (52%), Gaps = 27/267 (10%)

Query: 17  LSSHQVI---VDPDSVLDD----RQRFFLTN---------------AIVRSLKHESIHRI 54
           L +H +I   +D   +L D     + FF+TN               AI R +K E +  I
Sbjct: 14  LKNHNIISHELDAQVILSDIMGVTRDFFITNSHINVSKNTIKKFDHAIKRRVKREPVAYI 73

Query: 55  LGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLA 114
           +  ++F++    ++  T  PR ETELL+   + F      K   + +LD+GTG+G + L+
Sbjct: 74  IRKKEFWSQDFLVNQATLVPRAETELLIYKVVDFF-----KNKRINVLDIGTGSGCILLS 128

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPY 174
           +LKE    +GVG+DIS KA++ A++N+    +  R      D      G +D+IVSNPPY
Sbjct: 129 ILKELDLSRGVGIDISAKAIKTAQTNSKNLNLFHRSKFKVFDISKFNVGKYDLIVSNPPY 188

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I S  +  L  ++ +++P ++L+GG+DGL   R +    +  L K+GL ++EIG+NQ + 
Sbjct: 189 IPSKDIKNLSQDIINYEPLVALNGGLDGLDLIRKVIYKSNSLLKKNGLFAIEIGFNQYLK 248

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVLL 261
           V  + +      ++   DY  N R ++
Sbjct: 249 VSSLLKKYGFREMHRQCDYDHNVRCII 275


>gi|146311982|ref|YP_001177056.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Enterobacter sp. 638]
 gi|145318858|gb|ABP61005.1| [protein release factor]-glutamine N5-methyltransferase
           [Enterobacter sp. 638]
          Length = 276

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 131/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   Q   L++ + R    E +  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKARTYLLAFGETELTADQHAQLSDLLSRRKAGEPVAHLTGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S+ T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LYVSAATLIPRPDTECLVEHALA-RLPAT----ACRILDLGTGTGAIALALASERPDCQI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  N    G +      QS WF ++ G  F++IVSNPPYI+       
Sbjct: 137 TAVDVMPDAVALALRNVARLGFN-NVKIQQSSWFDALVGQQFEMIVSNPPYIDERDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+    I     +HL   G   +E G+ Q   V  +F    
Sbjct: 196 QGDVR-FEPLTALVAAEEGLADIAHIVTVSRQHLTAGGWLLIEHGWTQGEAVRALFTHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYGGNDR+ L
Sbjct: 255 YERVETCQDYGGNDRLTL 272


>gi|78221602|ref|YP_383349.1| modification methylase HemK [Geobacter metallireducens GS-15]
 gi|78192857|gb|ABB30624.1| [protein release factor]-glutamine N5-methyltransferase [Geobacter
           metallireducens GS-15]
          Length = 284

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 124/256 (48%), Gaps = 9/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L    GL    + V+ D  L+  +   +   + R  K E +  +LG ++F  +  
Sbjct: 32  ETEWLLSAALGLDRVGLYVNFDKPLNAEELSAVRGLVARRAKREPLQYVLGTQEFCGLDF 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PR +TE+LV+ AL              +LD+G G+G + +AL K  P  +  
Sbjct: 92  AVTPAVLIPRHDTEVLVEEALR------RAPHAATVLDIGVGSGCIAVALAKNLPDAQVW 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS-VEGLFDVIVSNPPYIESVIVDCLG 184
           GV+ S  A+ +A+ N   +GV  R        F    +  FD+IVSNPPYI +  +D L 
Sbjct: 146 GVEQSAGAITLARQNVERHGV--RVILCAGSLFEPFADQRFDLIVSNPPYIPTADLDTLQ 203

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVR+++PR +LDGG DGL  YR I      HLN  G   VE+G  Q   V+ +F+    
Sbjct: 204 PEVREYEPRAALDGGADGLDFYRIIVPAALEHLNAGGWLMVELGIGQAEAVLGMFKQAGF 263

Query: 245 FLVNAFKDYGGNDRVL 260
                 KD  G DRV+
Sbjct: 264 TGCFTAKDLNGIDRVV 279


>gi|327470058|gb|EGF15522.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK330]
          Length = 276

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 124/234 (52%), Gaps = 14/234 (5%)

Query: 30  LDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           L+DR++       V  L H+    I+G  DF+ + L +      PRPETE LV+  L+ +
Sbjct: 49  LEDREQLKAIQGQV--LAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSEN 106

Query: 90  LPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER 149
                    + +LD+GTG+GA+ LAL+   P ++    D+S  AL +A  NA + G+S  
Sbjct: 107 -----PESSLSVLDIGTGSGAIALALVNSRPDWQITASDLSKDALSLAADNAQSCGLSLT 161

Query: 150 FDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTI 209
           F  +QSD   S++G FD+IVSNPPYI     + +GL V   +P ++L    DG + YR I
Sbjct: 162 F--VQSDCLDSIQGKFDIIVSNPPYISEANKNEVGLNVLTSEPHMALFAEEDGCAVYRKI 219

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVL 260
           A+    +L + G   +EIGY Q   V  +   +K F    +   KD  G DR++
Sbjct: 220 AEQAGDYLTEKGKIYLEIGYKQGDSVRELL--KKSFPQKQIRVLKDQFGKDRMV 271


>gi|327393651|dbj|BAK11073.1| protein methyltransferase HemK [Pantoea ananatis AJ13355]
          Length = 280

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 132/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   ++   +++L + Q   L   + R  + E +  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRSWLVAFDETLLTEAQLQQLDVLLARRARGEPVAHLIGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L ++  T  PRP+TE+LV+ ALA  LP        R+LD+GTG+GA+ LA+  E P    
Sbjct: 82  LQVNDATLIPRPDTEILVEQALAH-LP----ESPARVLDMGTGSGAIALAIASERPDCDV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCL 183
           +GVD    A+ +A+ NA    +      +QS WF+ +    FD+IVSNPPYI++      
Sbjct: 137 IGVDRIPAAVALAQRNAAHLAIPNA-TFIQSHWFAQITPARFDLIVSNPPYIDANDRHLN 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L     GL+  R + +     L   G   +E G+ Q   V  + +   
Sbjct: 196 EGDVR-FEPRSALVAEEAGLADLRLLIEQAINWLQPGGWLLLEHGWQQDEAVRHLMQQHH 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V    DYGGN RV
Sbjct: 255 YLSVATANDYGGNPRV 270


>gi|289647288|ref|ZP_06478631.1| hemK protein [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 277

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLTRHGFERIQTRRDLGEHERITFGCK 275


>gi|262282282|ref|ZP_06060050.1| protoporphyrinogen oxidase [Streptococcus sp. 2_1_36FAA]
 gi|262261573|gb|EEY80271.1| protoporphyrinogen oxidase [Streptococcus sp. 2_1_36FAA]
          Length = 276

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 118/218 (54%), Gaps = 12/218 (5%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H+    I+G  DF+ + L +      PRPETE LV+  L+ +         V +LD+G
Sbjct: 63  LAHKPAQYIIGSSDFHGLNLKVDERVLIPRPETEELVELILSEN-----PESSVSVLDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ LAL    P ++    D+S  AL +A+ NA + G+S  F  +QSD   +++G F
Sbjct: 118 TGSGAIALALANSRPDWQITASDLSEDALSLARENARSCGLSLTF--VQSDCLDAIQGNF 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     D +GL V   +P ++L    DG   YR I +    +L + G   +
Sbjct: 176 DIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYEVYRKITEQAGDYLTEKGKIYL 235

Query: 226 EIGYNQK---VDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           EIGY Q    VD+++ F  +K   +   KD  G DR++
Sbjct: 236 EIGYKQGDGVVDLLKQFFPQK--RIRVLKDQFGKDRMV 271


>gi|258542229|ref|YP_003187662.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-01]
 gi|256633307|dbj|BAH99282.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-01]
 gi|256636366|dbj|BAI02335.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-03]
 gi|256639419|dbj|BAI05381.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-07]
 gi|256642475|dbj|BAI08430.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-22]
 gi|256645530|dbj|BAI11478.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-26]
 gi|256648583|dbj|BAI14524.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-32]
 gi|256651636|dbj|BAI17570.1| modification methylase HemK [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654627|dbj|BAI20554.1| modification methylase HemK [Acetobacter pasteurianus IFO 3283-12]
          Length = 292

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 138/260 (53%), Gaps = 7/260 (2%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           R++   L     L+  Q++    +     + FF  + + R   HE    I G + F+++ 
Sbjct: 34  REARLLLIHALSLTPEQLLARSPTENVPSEPFF--SYVNRRAAHEPFAYITGSKGFWSLD 91

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  +  PR +TE L+ S L +   R ++   + ILDLGTGTG + LA L E P   G
Sbjct: 92  LAVSPASLVPRGDTETLITSLLEY---RPDQTAALNILDLGTGTGCLLLAALAEYPKAHG 148

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDC 182
           VGVDI+ +A  +A +NA    +S+R   + ++W +++  +  FDV++SNPPYI +  +  
Sbjct: 149 VGVDINPQAAILAHANAQRCCMSDRALFMAAEWDAALVPDMRFDVVLSNPPYIPTSDLAD 208

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L  EVR+ +P  +LDGG DGL+ YR I   +   L   GL  +EIG  Q+  +  +  + 
Sbjct: 209 LMPEVREHEPVRALDGGDDGLNAYRYICSRLPFLLVDGGLAVLEIGIGQEEALRALASTN 268

Query: 243 KLFLVNAFKDYGGNDRVLLF 262
            L +V+   D  G  R ++ 
Sbjct: 269 VLRVVDVKADLAGIARAVVL 288


>gi|153801641|ref|ZP_01956227.1| hemK protein [Vibrio cholerae MZO-3]
 gi|124122818|gb|EAY41561.1| hemK protein [Vibrio cholerae MZO-3]
          Length = 286

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 129/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +       Q  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFFQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L  DG    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDDGWLLFEHGYDQGVAVRTIMRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|300313562|ref|YP_003777654.1| polypeptide chain release factors methylase [Herbaspirillum
           seropedicae SmR1]
 gi|300076347|gb|ADJ65746.1| polypeptide chain release factors methylase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 277

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 132/252 (52%), Gaps = 11/252 (4%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            LC    L+  Q+I   +  L   +   L   + R L+ E I  I+G R+FY + L +S 
Sbjct: 29  LLCHALRLTRVQLITQSERQLSAAEAETLAALLARRLRGEPIAYIVGQREFYGLDLRVSP 88

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRP+TELLV+ AL   LP+         LD+GTG+GA+ +A+    P  +   +D 
Sbjct: 89  DVLIPRPDTELLVELALE-RLPQGGS-----ALDMGTGSGAIAVAIAHTRPDAQVTALDA 142

Query: 130 SCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEV 187
           S  AL IA+ NA T+ V  R   L+SDW+ +++    FD+IVSNPPYI +  +     ++
Sbjct: 143 SPAALAIARENASTHQVRVRL--LESDWYGALDADQAFDLIVSNPPYIVAGDIHLSQGDL 200

Query: 188 RDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLV 247
           R F+P  +L    DGLS  RTI +G   HL   G   +E GY+Q   V  +        V
Sbjct: 201 R-FEPVDALTDHADGLSDLRTIIEGAPAHLKAGGWLLMEHGYDQAAAVRALLTGGGWREV 259

Query: 248 NAFKDYGGNDRV 259
            +++D  G +RV
Sbjct: 260 QSWRDLAGIERV 271


>gi|309379284|emb|CBX22057.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 273

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  +LGWR+FY  R  ++ +   PRPETE LV++ LA  LP     +  R+ D
Sbjct: 54  RRLNGEPVAYLLGWREFYGRRFAVNPNVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 107

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G +  F      WF +   
Sbjct: 108 LGTGSGAVAVTVALERPDAFVCASDISPSALETARKNAADLGAAVEF--AHGSWFDTDMP 165

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+        ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 166 SEGKWDIIVSNPPYIENGDEHLSQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 224

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 225 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|206578511|ref|YP_002237909.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Klebsiella pneumoniae 342]
 gi|206567569|gb|ACI09345.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Klebsiella pneumoniae 342]
          Length = 282

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTGRARTWILAFGETTLSADEATTLEALLQRRQRGEPIAHLIGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLPAVP----CRILDLGTGTGAIALALASERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA    ++      QSDWFS++ G  F +IVSNPPYI++      
Sbjct: 137 TAVDVMPDAVALALRNAAHLDIAN-VTIRQSDWFSALAGQRFAMIVSNPPYIDAADPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPLTALVAADQGLADLAQIIREGRQYLLPGGWMLLEHGWTQGEAVRALFREAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 255 YLDVATCRDYGDNERLTL 272


>gi|39998193|ref|NP_954144.1| HemK family modification methylase [Geobacter sulfurreducens PCA]
 gi|39985139|gb|AAR36494.1| modification methylase, HemK family [Geobacter sulfurreducens PCA]
 gi|298507131|gb|ADI85854.1| peptide chain release factor methyltransferase [Geobacter
           sulfurreducens KN400]
          Length = 284

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 126/256 (49%), Gaps = 9/256 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L    GL    + V+ D  L+  +       + R  K E +  ILG ++F  +  
Sbjct: 32  ETEWLLSAALGLDRVGLYVNFDKPLNPEELAACRGLVARRAKREPLQYILGTQEFCGLDF 91

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PR +TE++V+ AL              +LD+G G+G + +AL K+ P  + V
Sbjct: 92  VVTPSVLIPRHDTEVIVEEALR------RAPHAAAVLDIGVGSGCIAVALAKQLPHAQVV 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-EGLFDVIVSNPPYIESVIVDCLG 184
           GV+ S  A+ +A+ NA  +G   R    +   F  + +  FD+IVSNPPYI +  ++ L 
Sbjct: 146 GVEQSPGAIALAQRNAERHGA--RVTLFEGSLFEPLGDQRFDLIVSNPPYIPTADLEALQ 203

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EVR+++PR +LDGG DGL  YR I      +LN  G   VE+G  Q   V+ +F     
Sbjct: 204 PEVREYEPRAALDGGSDGLDFYRLIVPAAPEYLNPGGWLMVELGIGQAETVLGMFSRTGF 263

Query: 245 FLVNAFKDYGGNDRVL 260
                 +D  G DRV+
Sbjct: 264 CDCFTAQDPNGIDRVV 279


>gi|301060380|ref|ZP_07201243.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [delta proteobacterium NaphS2]
 gi|300445576|gb|EFK09478.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [delta proteobacterium NaphS2]
          Length = 299

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 118/223 (52%), Gaps = 4/223 (1%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R L+HE +  I G ++F+++   ++     PRPETE+LV+ A+  +    E+   +R 
Sbjct: 66  IKRRLEHEPLQYITGKQEFWSLSFQVNPHVLIPRPETEILVEQAMDLATALTEEGTQLRF 125

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+G + +A+ K+ P       DIS KAL++A++NA  +GVS     +Q D F  +
Sbjct: 126 LDLGTGSGVIAVAMAKQIPESLVFATDISGKALDVARANAQAHGVSSSITFIQGDLFEPL 185

Query: 162 ---EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
              +  F +I SNPPY+ +  +  L  E+  ++PR +LDGG DG+ + + I     R L 
Sbjct: 186 MLEKPAFHLIASNPPYVCTHEISGLQSEIALYEPRAALDGGKDGMDYLKEIIKQAPRFLL 245

Query: 219 KDGLCSVEIGYNQKVDVVRIFESRKLFL-VNAFKDYGGNDRVL 260
             G   +E+   Q    +       ++      +DY  + RV+
Sbjct: 246 PGGWLLLEMSPFQVEKALFALAETDVYQNTKPVQDYSHHQRVI 288


>gi|299065548|emb|CBJ36719.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Ralstonia solanacearum CMR15]
          Length = 306

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 127/260 (48%), Gaps = 15/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   +  VTGLS  Q+I      +DD  R  L     R L  E +  +LG R+F+    
Sbjct: 42  EARMLVSHVTGLSRVQLITQDTCGIDDGTRTRLAELATRRLAGEPMAYLLGEREFFGRMF 101

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG--AVCLALLKESPFFK 123
            ++     PRP+TELLV+ AL     RI+ RDV  +LDLGTG+G  AV +AL +     +
Sbjct: 102 QVTPAVLIPRPDTELLVEQALD----RIDDRDVPAVLDLGTGSGIIAVTIALARRD--AR 155

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-----EGLFDVIVSNPPYIESV 178
               D S  AL +A  NA   G +     L  DW++++       +FD+IVSNPPYI S 
Sbjct: 156 VWATDTSADALAVAVRNAQALGAANMHAAL-GDWYAALPESDAPPVFDLIVSNPPYIAST 214

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
                  ++R F+P  +L    DGL H RTI  G    L  DG   +E GY+Q   V  +
Sbjct: 215 DAHLGQGDLR-FEPAGALTDHGDGLRHLRTIVAGAPARLAADGWLLLEHGYDQGPAVRAL 273

Query: 239 FESRKLFLVNAFKDYGGNDR 258
                   V   +D  G+DR
Sbjct: 274 LADAGFADVFTAQDLAGHDR 293


>gi|296113366|ref|YP_003627304.1| protein methyltransferase HemK [Moraxella catarrhalis RH4]
 gi|295921060|gb|ADG61411.1| protein methyltransferase HemK [Moraxella catarrhalis RH4]
 gi|326559851|gb|EGE10251.1| protein methyltransferase HemK [Moraxella catarrhalis 7169]
 gi|326560801|gb|EGE11168.1| protein methyltransferase HemK [Moraxella catarrhalis 103P14B1]
 gi|326563538|gb|EGE13797.1| protein methyltransferase HemK [Moraxella catarrhalis 12P80B1]
 gi|326569661|gb|EGE19713.1| protein methyltransferase HemK [Moraxella catarrhalis BC1]
 gi|326570144|gb|EGE20189.1| protein methyltransferase HemK [Moraxella catarrhalis BC8]
 gi|326570883|gb|EGE20907.1| protein methyltransferase HemK [Moraxella catarrhalis BC7]
 gi|326574432|gb|EGE24374.1| protein methyltransferase HemK [Moraxella catarrhalis 101P30B1]
 gi|326575975|gb|EGE25898.1| protein methyltransferase HemK [Moraxella catarrhalis CO72]
          Length = 295

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 126/229 (55%), Gaps = 10/229 (4%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS-----LPR 92
           +T  I++    + +  + G + F+     +++ T  PR +TE+LV++ L ++     + +
Sbjct: 65  ITAGIMQLSAGKPLAYLTGQQSFWGRHFLVNAHTLIPRADTEILVETILNYAKAQQKIRQ 124

Query: 93  IEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDT 152
            + +++V ILDLGTGTG + + L  E  F + V VDIS +AL++A+ N   + ++ R   
Sbjct: 125 TDNKNLVNILDLGTGTGCIGITLALELEFAQVVLVDISSEALKVAEQN--NHRLNARCQL 182

Query: 153 LQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADG 212
           LQS W   V G FD+IVSNPPYI+      + L+    +P  +L    DGL+  R I + 
Sbjct: 183 LQSHWLQKVSGQFDIIVSNPPYIKENDEHLVNLK---HEPITALVAAEDGLTDIRHIIET 239

Query: 213 VSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
              +L   GL ++E G++Q   V  ++ S     V   +DYGGNDRV L
Sbjct: 240 GRAYLKDGGLMAIEHGFDQAEAVRNLYLSSGYLDVYTIQDYGGNDRVTL 288


>gi|282850387|ref|ZP_06259766.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella parvula ATCC 17745]
 gi|282579880|gb|EFB85284.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella parvula ATCC 17745]
          Length = 289

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 123/218 (56%), Gaps = 9/218 (4%)

Query: 47  KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGT 106
           K   +  I+G +DF  +   ++     PRP+TE L++  L  + P   K   VRILD+ T
Sbjct: 71  KGHCVAAIIGEKDFMGLTFKVNDKVLIPRPDTETLIEHVLG-TYP---KDSNVRILDVCT 126

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--- 163
           G G + L+LL   P   GVG+DIS  AL +A+ N  +  +S+R   ++SD F ++ G   
Sbjct: 127 GPGTILLSLLHYLPNASGVGLDISTDALPVARENGESFNLSDRVQFMESDMFHTLYGKKE 186

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI +  +  L  +V + +P I+L GG DGL  YR +A     +LN +G  
Sbjct: 187 KFDLIVSNPPYIRTGDLKMLSPDVLN-EPHIALFGGEDGLQFYRILAKECRNYLNANGRV 245

Query: 224 SVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           + E+G++Q  +V  +  E+ +   +    D GG++RV+
Sbjct: 246 AFEVGFDQAEEVGALLQETGQYSNIQFIADLGGHNRVV 283


>gi|288934822|ref|YP_003438881.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Klebsiella variicola At-22]
 gi|288889531|gb|ADC57849.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Klebsiella variicola At-22]
          Length = 282

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 132/258 (51%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG +   ++   ++ L   +   L   + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGHVTGRARTWILAFGETTLSADEATTLEALLQRRQRGEPIAHLVGQREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP +      RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLPAVP----CRILDLGTGTGAIALALASERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
             VD+   A+ +A  NA    ++      QSDWFS++ G  F +IVSNPPYI++      
Sbjct: 137 TAVDVMPDAVALALRNAAHLDIAN-VTIRQSDWFSALAGQRFAMIVSNPPYIDAADPHLA 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+    I     ++L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPLTALVAADQGLADLAQIIREGRQYLLPGGWMLLEHGWTQGEAVRALFREAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+R+ L
Sbjct: 255 YLDVATCRDYGDNERLTL 272


>gi|327538346|gb|EGF25019.1| modification methylase, HemK family [Rhodopirellula baltica WH47]
          Length = 296

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 130/259 (50%), Gaps = 5/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G    ++    D V ++ QR      + R  +   + +++G+R+FY++ +
Sbjct: 34  DAEILLAHARGCQRIELYTSFDKVPEEEQRVAFRELVRRRGEGAPVAQLVGYREFYSISI 93

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +  +   PRPETE LV  A+     R+  R    +LD+GTG+GA+ +A+ K  P  +  
Sbjct: 94  RVDENVLVPRPETEHLVIEAIDQIKGRMSDRPSPTVLDIGTGSGAIAVAIAKSLPKTQVT 153

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCL 183
            VDIS  AL+IAK N     +S+R   LQSD F  +E    FDVI SNPPYI     D L
Sbjct: 154 AVDISLTALDIAKWNVENLKLSDRVTLLQSDLFDGLEPDQTFDVICSNPPYISQSEYDEL 213

Query: 184 GLEVRDFDPRISLDGGIDGLSHY-RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              VR+F+PR +L  G DG     R + D V R LN  G   +E+          + E  
Sbjct: 214 PTTVREFEPRGALLSGPDGTEIIARLLTDSVQR-LNDGGQLIIELSPMIAGVCKTLAEQN 272

Query: 243 KLFL-VNAFKDYGGNDRVL 260
             +  ++  KD  G++R+L
Sbjct: 273 GGYQEIHLIKDLAGHERIL 291


>gi|260436445|ref|ZP_05790415.1| modification methylase, HemK family [Synechococcus sp. WH 8109]
 gi|260414319|gb|EEX07615.1| modification methylase, HemK family [Synechococcus sp. WH 8109]
          Length = 295

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 107/208 (51%), Gaps = 10/208 (4%)

Query: 57  WRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALL 116
           WRD   V L  S     PR ETELLVD A++    + +     R  DLGTG+GA+ +AL 
Sbjct: 87  WRD---VLLESSPAALIPRQETELLVDLAMS----QFKTTPPARWADLGTGSGAIAVALA 139

Query: 117 KESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE---GLFDVIVSNPP 173
           +  P   G GVD+S  AL++A+ N                W+S ++   G  D++VSNPP
Sbjct: 140 RAWPTAPGHGVDLSPDALQLAEHNLQGCAPHHNCSLHLGSWWSPLKSWWGSLDLVVSNPP 199

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YI   +VD L   VRD +P ++L GG DGL   RT+ DG    L+  G   +E  Y+Q V
Sbjct: 200 YIPCAVVDGLEAVVRDHEPHLALLGGADGLDAIRTVVDGAPTGLSPGGWLLLEHHYDQSV 259

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            V+++ +   L  V A  D  G  R  L
Sbjct: 260 QVIQLLQDAGLVEVRAAADLEGTLRFAL 287


>gi|254482780|ref|ZP_05096017.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [marine gamma proteobacterium HTCC2148]
 gi|214036861|gb|EEB77531.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [marine gamma proteobacterium HTCC2148]
          Length = 277

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 8/219 (3%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R  + E +  + G R+F+++ L ++  T  PRPETE LV+ AL   LP     D    
Sbjct: 58  LQRRYRGEPVAYLTGHREFWSLDLAVAPSTLIPRPETETLVEWALELPLP-----DDTVA 112

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTGTGA+ LAL  E P ++  G D++  A+++A +NA+ N ++ R + +QSDWF  V
Sbjct: 113 LDLGTGTGAIALALANEKPGWRVCGADVNIDAVQLASNNALANNLA-RVEFIQSDWFDGV 171

Query: 162 E-GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           E  LF+++VSNPPY+E         +VR F+P  +L     GL+    I      +L   
Sbjct: 172 EDKLFNLLVSNPPYVEEGDAHLSEGDVR-FEPLEALVAADRGLADLDHIVKSSPNYLQTR 230

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
           G   +E G++Q   V  +   R    V   +D  G +R+
Sbjct: 231 GWLLLEHGFDQAPAVRELLVRRGFKGVETRQDLAGQERI 269


>gi|94496667|ref|ZP_01303243.1| protein chain release factors methylase subunit [Sphingomonas sp.
           SKA58]
 gi|94424027|gb|EAT09052.1| protein chain release factors methylase subunit [Sphingomonas sp.
           SKA58]
          Length = 244

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 124/226 (54%), Gaps = 14/226 (6%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R    E +  I+G RDF+ + L ++ DT  PRP++E L+++A+ +       +    +
Sbjct: 29  IARRAAGEPVAHIIGMRDFWTITLAVTPDTLIPRPDSETLIEAAVDY----FGAQGPQTV 84

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LDLGTG+GA+ LA L + P  +G+G+D S  AL +A+ NA    +  R +    DW + V
Sbjct: 85  LDLGTGSGALLLAALAQWPQARGLGIDASAGALLVARGNAARLDLDARAEFRAGDWATGV 144

Query: 162 EGLFDVIVSNPPYI---ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLN 218
           EG+FD+++ NPPYI   E +  D L       +P  +L  G+DGL  YR IA  + R + 
Sbjct: 145 EGVFDLLLINPPYIGVDEPLSGDVL------REPASALFAGVDGLDDYRRIAPDLPRLIA 198

Query: 219 KDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             G+ ++EIG+ Q   V  +  ++ L  V   +D  G DR ++  R
Sbjct: 199 PGGMAAIEIGHRQGDSVGALVAAQGLN-VAIRRDLAGLDRCVIATR 243


>gi|222053789|ref|YP_002536151.1| modification methylase, HemK family [Geobacter sp. FRC-32]
 gi|221563078|gb|ACM19050.1| modification methylase, HemK family [Geobacter sp. FRC-32]
          Length = 284

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 132/257 (51%), Gaps = 10/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   LC V GL    + V+ D  L  ++       I R  + E +  ILG ++F  +  
Sbjct: 31  ESEWMLCAVLGLDRMGLYVNFDKPLTPKELADYRGMIARRGRREPLQYILGSQEFMGLDF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PR +TE+LV+ A+     R  K     ILD+GTG+G + ++L K  P     
Sbjct: 91  AVAPAVLIPRHDTEVLVNEAVK----RAGKTS--SILDVGTGSGCISISLAKALPGAIIT 144

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
           GVD S  AL +A+ N  T+GV+ +   L    F  V+G  F ++VSNPPYI S  +  L 
Sbjct: 145 GVDTSVDALAVAEKNCNTHGVAVKL--LHGSLFEPVQGQQFHMVVSNPPYIPSDDLKTLQ 202

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI-FESRK 243
            EVRD++P  +LDGG DGL  YR I    + +L   G   +E+G  Q   V ++ F++ K
Sbjct: 203 PEVRDYEPAGALDGGKDGLDFYRQIVAAATDYLVCGGWLLLEVGIGQAEQVRKLFFDNGK 262

Query: 244 LFLVNAFKDYGGNDRVL 260
              V A KD    +RV+
Sbjct: 263 FAEVFAAKDTADIERVV 279


>gi|325847860|ref|ZP_08170082.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480878|gb|EGC83931.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 263

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 121/209 (57%), Gaps = 8/209 (3%)

Query: 55  LGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLA 114
           +G  +FY + L +      PR ETE+LVD  +   +    K+D  +ILD+G+G+GA+ LA
Sbjct: 62  IGKWNFYGLDLLVDKRALIPRYETEILVDMIINDKV----KKD--KILDIGSGSGAISLA 115

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPY 174
           L       K +G+DIS  A+ ++K N   N   +  +  +SD FS+VEG FD+IVSNPPY
Sbjct: 116 LSYNLKNSKVLGIDISKDAINLSKENK-KNLSIKNVEFKESDIFSNVEGKFDIIVSNPPY 174

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I     + L  ++  ++P+ +L GG DGL  YR I     + LNK+G   +EIGY+QK  
Sbjct: 175 INKEDFENLDKKLS-YEPQNALLGGDDGLFFYRKIILNAKKFLNKNGKIYLEIGYDQKNP 233

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           ++ + +      + A+KD+   DR+++ C
Sbjct: 234 IINLLKEEGYKDIRAYKDFNDFDRIIIAC 262


>gi|295677814|ref|YP_003606338.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. CCGE1002]
 gi|295437657|gb|ADG16827.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia sp. CCGE1002]
          Length = 295

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 128/262 (48%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L  V G    Q+I   +  L+            R +  E + +++G R+F+ +  
Sbjct: 31  EARILLTHVLGWRRTQLITRSEEPLERASVECYRALEARRMAGEPVAQLVGAREFFGLEF 90

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++     PRPETELLV++ALA     IE R   R+LDLGTGTGA+ +A+    P     
Sbjct: 91  EVTPHVLIPRPETELLVETALAA----IEARPRPRVLDLGTGTGAIAVAIASMRPEAHVW 146

Query: 126 GVDISCKALEIAKSN------AVTNGVSERFDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
            +D S  AL +A  N      A   G +  F  L SDW+ S++    FD IVSNPPYI S
Sbjct: 147 ALDRSADALAVAARNGARLLDAKRPGGAVTF--LHSDWYGSLDTALRFDAIVSNPPYIAS 204

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  R I  G    L  DG+  +E GY+Q   V  
Sbjct: 205 GDPHLAEGDLR-FEPRGALTDEADGLSAIRAIIAGAPERLAADGVLWIEHGYDQAEAVRA 263

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  +R    V + +D  G +R+
Sbjct: 264 LLGARGFAEVRSERDLAGIERI 285


>gi|37525988|ref|NP_929332.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785418|emb|CAE14364.1| Protein methyltranferase HemK (Protein-glutamine
           N-methyltransferase) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 282

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 135/258 (52%), Gaps = 12/258 (4%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VT  S   ++   ++ L   Q   L   + R +K E I  I G R+F+++ 
Sbjct: 22  RDAEILLGFVTHHSRTYLLAFGETQLAPEQFSQLEALLARRVKGEPIAYITGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALA-FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
           L +S  T  PRP+TE LV+ AL   SL         RILDLGTGTGA+ LA+  E P  +
Sbjct: 82  LNVSPATLIPRPDTECLVEKALERLSL------TPCRILDLGTGTGAIALAIASERPDCR 135

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
             GVDI+  A+ +A+ NA    + +  D L S+WF S+    F +IVSNPPYI+      
Sbjct: 136 VTGVDINPDAVMLAQGNAEKLKI-QNVDFLLSNWFFSLNNQQFGMIVSNPPYIDETDPHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH-LNKDGLCSVEIGYNQKVDVVRIFES 241
              +VR F+P  +L     G++   TI D +SRH L   G   +E G+ Q   +  +F  
Sbjct: 195 SQGDVR-FEPDSALIAAKQGIADLNTIID-LSRHFLLPGGWLLLEHGWKQGNVIRSLFSE 252

Query: 242 RKLFLVNAFKDYGGNDRV 259
                V  F+DYGGN+R+
Sbjct: 253 SGYRQVATFQDYGGNERI 270


>gi|225677173|ref|ZP_03788171.1| modification methylase, HemK family [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590797|gb|EEH12026.1| modification methylase, HemK family [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 279

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 140/260 (53%), Gaps = 8/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVD-PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           D    +  V G+    +I++  D V  +++  F      R+ ++  I +I+G R+F++  
Sbjct: 26  DCEIIMQHVLGVERSFIIMNHADQVPMEKELLFWKLTKKRAERY-PISQIIGNREFWSKN 84

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
             ++    +PRP++E L+ + L +  P  ++R  ++I D GTGTG + +++L E  +  G
Sbjct: 85  FIVNQHVLDPRPDSETLISTVLKY-YPNKKQR--LKIADFGTGTGCLLISVLSEHEYAVG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           +G + S +A ++A  N   + +  R     S W +   G FD+I+SNPPYI+   +  L 
Sbjct: 142 IGFEKSLEAYKVAYQNTKKHDLLSRAKIFPSSW-TECRGSFDLIISNPPYIKRSKLKDLQ 200

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV+  +PRI+LDGGIDGL+ Y +I   + + L K+G   +EIG +Q  D+ +I  S KL
Sbjct: 201 AEVQK-EPRIALDGGIDGLNCYLSIFPILKKCLKKNGFAILEIGEDQN-DIDKIIPSYKL 258

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
                  D  G  R ++  +
Sbjct: 259 AFQEYVHDLAGMKRCIVMQK 278


>gi|91785344|ref|YP_560550.1| modification methylase HemK [Burkholderia xenovorans LB400]
 gi|91689298|gb|ABE32498.1| [protein release factor]-glutamine N5-methyltransferase
           [Burkholderia xenovorans LB400]
          Length = 286

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 132/262 (50%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           ++   L  V G    Q+I   D  L     +R+    A  R    E + +++G R+F+ +
Sbjct: 25  EARILLTHVLGWRPTQLITRSDEPLGAELVERYRALEA--RRAAGEPVAQLVGAREFFGL 82

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++     PRPETELLV++ALA     +E     R+LDLGTGTGA+ +A+    P  +
Sbjct: 83  DFEVTPHVLIPRPETELLVETALAA----LENLSRPRVLDLGTGTGAIAVAIASMRPDAQ 138

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S +AL +A  NA     ++R        QSDW+ S++    FDVIVSNPPYI S
Sbjct: 139 VWALDHSAEALAVATRNAARLLDAKRPGGAVALTQSDWYDSLDAALRFDVIVSNPPYIAS 198

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  R I  G    L   G+  +E GY+Q   V +
Sbjct: 199 GDPHLAQGDLR-FEPRGALTDEADGLSAIRAIIAGAPTRLAAGGVLWIEHGYDQAEAVRK 257

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  +R    V + +D  G +R+
Sbjct: 258 LLTARGFTQVRSERDLAGIERI 279


>gi|330828703|ref|YP_004391655.1| protein-(glutamine-N5) methyltransferase [Aeromonas veronii B565]
 gi|328803839|gb|AEB49038.1| Protein-(Glutamine-N5) methyltransferase, release factor-specific
           [Aeromonas veronii B565]
          Length = 283

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 89/263 (33%), Positives = 127/263 (48%), Gaps = 15/263 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC + G     ++  P+  LD  Q+  L   + R L  E I  ++G R+F+++ L
Sbjct: 23  DADVLLCHLLGCRRSYLMTWPEHELDAAQQATLQGWLARRLNGEPIAHLVGEREFWSLPL 82

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE+LV+ AL     RI +     +LDLGTGTGA+ LAL  E P     
Sbjct: 83  KVSPATLIPRPDTEVLVEQALT----RIPQGPCA-VLDLGTGTGAIALALKSERPEIDVW 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-------EGLFDVIVSNPPYIESV 178
            VD    A  +A+ N+V  G+    +     WF  +          F VIVSNPPYI+  
Sbjct: 138 AVDRMADAAALARENSVALGLP--IEVRDGSWFEPLGEPDRDETPRFAVIVSNPPYIDGA 195

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
                  +VR F+PR +L     GL+  R I      +L  DG   +E G++Q   V ++
Sbjct: 196 DPHLEQGDVR-FEPRSALVADDAGLADIRHIVAHAPAYLLADGWLLLEHGWDQGEAVRQL 254

Query: 239 FESRKLFLVNAFKDYGGNDRVLL 261
                   V   +DYG NDRV L
Sbjct: 255 LRDGGYREVATVRDYGDNDRVTL 277


>gi|197249709|ref|YP_002146254.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197213412|gb|ACH50809.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
          Length = 277

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-QLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YMDVETCRDYGGNERV 270


>gi|332360426|gb|EGJ38237.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK355]
          Length = 276

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 115/218 (52%), Gaps = 12/218 (5%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H+    I+G  DF+ + L +      PRPETE LV+  L+ +         + +LD+G
Sbjct: 63  LAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSEN-----PESSLSVLDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ LAL    P ++    D+S  AL +A  NA   G++  F  +QSD   +++G F
Sbjct: 118 TGSGAIALALANSRPDWQITASDLSEDALSLAAENAQNCGLNPTF--VQSDCLDTIQGKF 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     D +GL V   +P ++L    DG + YR IA+    +L + G   +
Sbjct: 176 DIIVSNPPYISEADKDEVGLNVLTSEPNMALFAEEDGYAVYRKIAEQAGGYLTEKGKIYL 235

Query: 226 EIGYNQKVDVVRIFESRKLFL---VNAFKDYGGNDRVL 260
           EIGY Q   V  +   +K F    +   KD  G DR++
Sbjct: 236 EIGYKQGEGVAELL--KKFFPHKRIRVLKDQFGKDRMV 271


>gi|322374350|ref|ZP_08048864.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus sp. C300]
 gi|321279850|gb|EFX56889.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus sp. C300]
          Length = 278

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 131/260 (50%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCR-VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +S SF+ R +  LS    +      + + ++ F+     +   H+    I+G  DF+ ++
Sbjct: 22  ESLSFVYRSLKNLSFTDFVFALQQEVTEAEKQFVEEIFQQLASHKPAQYIIGQADFFGMQ 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +      PRPETE LV+  LA +       D +++LD+GTG+GA+ L L K  P +  
Sbjct: 82  LKVDERVLIPRPETEELVELILAEN-----PEDKLKVLDIGTGSGAIALGLAKNRPDWSV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
              DIS  ALE+A  NA    ++  F   +SD F+ +   +D+IVSNPPYI       +G
Sbjct: 137 TAADISQDALELASENARNQNLNIFFK--KSDCFAEISEKYDIIVSNPPYISREDESEVG 194

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
           L V   +P ++L    DGL+ YR IA+    +L   G   +EIGY Q   V  +F  RK 
Sbjct: 195 LNVLHSEPHLALFADEDGLAIYRRIAEDAKDYLTDGGKIYLEIGYKQGQSVPALF--RKY 252

Query: 245 F---LVNAFKDYGGNDRVLL 261
                V   KD  G DR+++
Sbjct: 253 LPEKRVRTLKDQFGQDRMVV 272


>gi|226940812|ref|YP_002795886.1| HemK1 [Laribacter hongkongensis HLHK9]
 gi|226715739|gb|ACO74877.1| HemK1 [Laribacter hongkongensis HLHK9]
          Length = 276

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 130/258 (50%), Gaps = 15/258 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+H  L + +GLS  + I  P+  + +   QRF    A  R L  E +  +LG R+F+  
Sbjct: 19  DAHLLLEQASGLSRTRQITWPEQEVPEETAQRFLALAA--RRLAGEPVAYLLGVREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ DT  PRPETE LV+ AL    P        R+LDLGTG+GA+ + +  E P  +
Sbjct: 77  DFRVTPDTLIPRPETEHLVEFALTHLPP------AGRMLDLGTGSGAIAVTVACERPDAR 130

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVD 181
              +D+S  AL +A+SN        R+  L+SDWFS++  E  F++IVSNPPYI +    
Sbjct: 131 VTALDVSAAALAVARSNGQHLQAQVRW--LESDWFSALPAEERFELIVSNPPYIAAGDPH 188

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               ++R F+P  +L    DGL   + +A      +   G  +VE GY+Q      +F  
Sbjct: 189 LEQGDLR-FEPASALTDFADGLEALQVLATQACHFVTPGGWLAVEHGYDQGKACRALFAG 247

Query: 242 RKLFLVNAFKDYGGNDRV 259
                V+   D  G DRV
Sbjct: 248 AGWLSVSTLPDLAGLDRV 265


>gi|149174662|ref|ZP_01853287.1| hemK protein [Planctomyces maris DSM 8797]
 gi|148846356|gb|EDL60694.1| hemK protein [Planctomyces maris DSM 8797]
          Length = 309

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 128/263 (48%), Gaps = 15/263 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L         ++  + + V+ +++R  +   + R    E +  ++G R+F+ +  
Sbjct: 47  DTEVLLAHARNCERIRLYTNYEDVVTEQERALMRQLVQRRANSEPVAYLVGNREFFGLDF 106

Query: 66  TLSSDTFEPRPETELLV----DSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPF 121
            +  +   PRP+TE LV    D A   + P I        LDL TG+G + ++       
Sbjct: 107 YVDKNVLVPRPDTETLVIELVDEAQKLTNPFI--------LDLCTGSGCIAISAAANCHN 158

Query: 122 FKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVI 179
            K    DIS  AL IA+ NA +N +S +   L SD F  +    LFD+IVSNPPYI    
Sbjct: 159 AKFQATDISEPALAIAQKNAASNELSNQIQFLLSDCFEQIPPGTLFDIIVSNPPYIPDAE 218

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           ++ L  +VR  +PR++L GG DGL  YR I     R+L   GL  +E    Q+ D++ +F
Sbjct: 219 IEQLEKDVRQHEPRLALSGGKDGLDFYRKIIQEAGRYLKDQGLLMLEFSPEQEADLLALF 278

Query: 240 ESRKLFL-VNAFKDYGGNDRVLL 261
           ++   +  V    D  G  RV++
Sbjct: 279 KATGEYTNVRVKADLAGRARVII 301


>gi|184158673|ref|YP_001847012.1| methylase of polypeptide chain release factor [Acinetobacter
           baumannii ACICU]
 gi|332874368|ref|ZP_08442279.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6014059]
 gi|183210267|gb|ACC57665.1| Methylase of polypeptide chain release factor [Acinetobacter
           baumannii ACICU]
 gi|322507516|gb|ADX02970.1| Methyl transferase [Acinetobacter baumannii 1656-2]
 gi|323518588|gb|ADX92969.1| methylase of polypeptide chain release factor [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332737447|gb|EGJ68363.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6014059]
          Length = 271

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 114/217 (52%), Gaps = 12/217 (5%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP+        I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLNLNLPK-----NANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-GLFD 166
           GA+ LAL  E P +     DI    L++AK NA T+G+   +F      WF ++E   FD
Sbjct: 118 GAIALALASERPDWFVTATDIYAPTLDVAKENAQTHGLHHVKFAC--GAWFEALEPQQFD 175

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           +IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E
Sbjct: 176 LIVSNPPYIDP---EDEHMQALATEPRRALVADHHGLADIEIIIAQGKNWLKPQGWIALE 232

Query: 227 IGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
            GY+Q   V  +F       +   +DYG NDRV L C
Sbjct: 233 HGYDQGQAVRNVFAEHGFSEIKTIQDYGQNDRVTLAC 269


>gi|156741368|ref|YP_001431497.1| HemK family modification methylase [Roseiflexus castenholzii DSM
           13941]
 gi|156232696|gb|ABU57479.1| modification methylase, HemK family [Roseiflexus castenholzii DSM
           13941]
          Length = 289

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 131/261 (50%), Gaps = 12/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVD-PDSVLDDRQRFFLTNAIV-RSLKHESIHRILGWRDFYNV 63
           D+   L    G S  +V+    +++ DD  + F   A+V R    E +  + G ++FY +
Sbjct: 31  DAEILLAHTLGWSRARVLARLQETIPDDALQTF--RALVERRAAREPVAYLTGRKEFYGL 88

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              +      PRPETE LVD+AL ++       D + I D+GTG+G + + L +  P   
Sbjct: 89  EFVVDRRVLVPRPETEALVDAALEWARQHYSPHDTLLIADIGTGSGCIAIVLARHLPNAV 148

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCL 183
               D+S  AL +A+ NA  +GV+ER   L  D  + +    D+ VSNPPY    I++ +
Sbjct: 149 VYATDLSPDALAVARQNAELHGVAERITLLCGDLLAPLPQAVDLAVSNPPY---TILNEI 205

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
              VR  +P ++LDGG DGL+ YR +     + L   G   +EIG  Q   V  +  +R+
Sbjct: 206 DAGVRLHEPHLALDGGSDGLAVYRRLLATAPQALRPGGALMLEIGATQAEAVTAL--ARQ 263

Query: 244 LF---LVNAFKDYGGNDRVLL 261
            F    V+  +D  G DRV++
Sbjct: 264 AFPAAAVHMLRDLAGWDRVVV 284


>gi|253583343|ref|ZP_04860541.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium varium ATCC 27725]
 gi|251833915|gb|EES62478.1| polypeptide chain release factor methyltransferase HemK
           [Fusobacterium varium ATCC 27725]
          Length = 369

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 118/221 (53%), Gaps = 6/221 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I+R    + +  +LG  +FY     +      PR +TE+LV+    F L  +E     ++
Sbjct: 147 ILRGKNRKPLQYLLGEWEFYGYPFKVDERVLIPRSDTEILVEQC-KFILNELENP---KV 202

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV 161
           LD+GTG+GA+ + L KE P    +G DIS  ALE+A++N   N  +E    ++SD FSS 
Sbjct: 203 LDIGTGSGAIAVTLGKECPNSVIIGADISEGALEVAEANREMNK-AENVKFMKSDVFSSF 261

Query: 162 EGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           + + FD I+SNPPYI     + L  EV  ++P  +L    +G   Y  I+   S +LNK 
Sbjct: 262 KDMKFDFIISNPPYIPLEEYNKLMPEVLKYEPSSALTDNGNGYYFYSKISKEASDYLNKG 321

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G  + E+GYNQ   V  + E     +    KDYGG DRV++
Sbjct: 322 GFLAFEVGYNQAETVKELMEENGFDIFAIVKDYGGIDRVVI 362


>gi|257482008|ref|ZP_05636049.1| hemK protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 277

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRCTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|34499039|ref|NP_903254.1| HemK protein [Chromobacterium violaceum ATCC 12472]
 gi|34104889|gb|AAQ61246.1| HemK protein [Chromobacterium violaceum ATCC 12472]
          Length = 254

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 16  GLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPR 75
           GL+   ++  P+  L +           R L  E I  +LG R+FY     +S     PR
Sbjct: 9   GLTHATILGHPERELPEETASAFDALAARRLAGEPIAYLLGSREFYGRDFRVSPAVLIPR 68

Query: 76  PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALE 135
           PETE LV+ AL+    R+++    R +DLGTG+G + + L  E+P +    VD+S +AL 
Sbjct: 69  PETEHLVEQALS----RVDRTMPARAVDLGTGSGIIAITLALEAPDWSLGAVDVSAEALA 124

Query: 136 IAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPR 193
           +A+ NA  + +  R D     WF  +  +  F++IVSNPPYIE         ++R F+PR
Sbjct: 125 VARGNA--DALGARVDFRLGSWFGPLDADARFELIVSNPPYIERGDHHLAEGDLR-FEPR 181

Query: 194 ISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDY 253
            +L    DGL+  R IA G    L   G   VE GY+Q   V  +F    L  V    D 
Sbjct: 182 GALTDEADGLACLREIAAGAPGRLADGGWLMVEHGYDQGEAVRGLFADAGLLEVETIVDL 241

Query: 254 GGNDRVLL 261
            G DR+ +
Sbjct: 242 AGQDRITI 249


>gi|218708756|ref|YP_002416377.1| hypothetical protein VS_0753 [Vibrio splendidus LGP32]
 gi|218321775|emb|CAV17731.1| Protein hemK homolog [Vibrio splendidus LGP32]
          Length = 290

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 129/272 (47%), Gaps = 25/272 (9%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  P+  L   Q       + R L  E +  I+G R+F+++ L
Sbjct: 29  DATVLLCHALDKPRSYLLTWPEKHLTSEQESEFNTLLKRRLTGEPVAYIVGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P     
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTYGKQGA-----ILDLGTGTGAIALALASEMPNRPVT 143

Query: 126 GVDISCKALEIAKSNA----VTNGVSERFDTLQSDWFSSVEGL--------FDVIVSNPP 173
           G+D+  +A ++A  NA    +TN        L   WF  +  +        F +IVSNPP
Sbjct: 144 GIDLRPEAQQLATENAQRLNITNAT-----FLHGSWFEPLNSVNSEEKAVKFSLIVSNPP 198

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YIE         +VR F+P  +L     GL+  R I++     L  +G  + E GY+Q +
Sbjct: 199 YIEKNDPHLSQGDVR-FEPITALVAEEKGLADIRYISENARSFLENEGWLAFEHGYDQGL 257

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLL--FC 263
            V  I ++     V   KDYGGNDRV L  +C
Sbjct: 258 AVREIMQALGYLDVVTEKDYGGNDRVTLGRYC 289


>gi|330988604|gb|EGH86707.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 277

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 120/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|304440461|ref|ZP_07400350.1| protein-(glutamine-N5) methyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304371213|gb|EFM24830.1| protein-(glutamine-N5) methyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 267

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 125/226 (55%), Gaps = 8/226 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           +S   L  V  +S   +I++ +  L+  +   + + + R    E +  ILG  +FY + +
Sbjct: 25  ESRRILMEVLDVSMTYLILNEEQELNKEKEEEIIDILNRRKHGEPLQYILGHSEFYGLDI 84

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            L      PRP+TE+ V++ L     R++  D  + L+LG G+GAV  ++ K S   K  
Sbjct: 85  LLKGKVLIPRPDTEVSVENILK----RLKSGD--KFLELGVGSGAVICSVAKNSDA-KCY 137

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS  ALE  K N + N   +  +   SD F +VEG +D+I SNPPYI+S  +  L +
Sbjct: 138 GVDISEDALECTKLN-IENLNLKNVEVKYSDLFENVEGKYDIIYSNPPYIKSHEILNLQV 196

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
           E+ D++PR++LDGG DGL  Y+ I      +LN+ G    EIG++Q
Sbjct: 197 EITDYEPRLALDGGEDGLDFYKKIISEYRDYLNEGGYLIFEIGHDQ 242


>gi|289627917|ref|ZP_06460871.1| hemK protein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|320325691|gb|EFW81752.1| hemK protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327390|gb|EFW83404.1| hemK protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330868899|gb|EGH03608.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 277

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|330881881|gb|EGH16030.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 277

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|56413304|ref|YP_150379.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197362229|ref|YP_002141866.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|56127561|gb|AAV77067.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197093706|emb|CAR59178.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 277

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 134/256 (52%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRRQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    + +    LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-QNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YTDVETCRDYGGNERV 270


>gi|270261429|ref|ZP_06189702.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia odorifera 4Rx13]
 gi|270044913|gb|EFA18004.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia odorifera 4Rx13]
          Length = 277

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 129/258 (50%), Gaps = 8/258 (3%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           A RD+   L  VTG +   ++   ++VL  +++  L   + R  + E +  ++G R+F++
Sbjct: 20  ARRDAEILLGFVTGRARTFLMAFGETVLTPQEQEQLERLLARRERGEPVAYLIGEREFWS 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L++S  T  PRP+TE LV+ AL    P         ILDLGTGTGA+ LAL  E P  
Sbjct: 80  LPLSVSPATLIPRPDTECLVELALERLPP-----SPCTILDLGTGTGAIALALASERPDC 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
              GVD+  +A+ +A+ NA    +      LQ  WF  + G  F +I SNPPYI++    
Sbjct: 135 AVTGVDLQPEAVALAQHNAQKLAIGNA-QFLQGSWFEPLAGQTFVLIASNPPYIDAADPH 193

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P  +L     GL+    I      +L   G   +E G+ Q   V  + ++
Sbjct: 194 LAQGDVR-FEPSSALVAQQHGLADLAAIVQQAPHYLQPQGWLLLEHGWQQGESVRALLQA 252

Query: 242 RKLFLVNAFKDYGGNDRV 259
                V   +DYG NDRV
Sbjct: 253 AGFISVATRRDYGDNDRV 270


>gi|323492376|ref|ZP_08097529.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio brasiliensis LMG 20546]
 gi|323313423|gb|EGA66534.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio brasiliensis LMG 20546]
          Length = 286

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 129/259 (49%), Gaps = 11/259 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +L   Q       + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHALDKPRSFLLTWPDKILPSSQLDAFQALLERRLSGEPVAYIVGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +L      +   ILDLGTGTGA+ LAL  E P  +  
Sbjct: 89  KVSPSTLIPRPDTERLVEIALDKAL-----NNQGDILDLGTGTGAIALALASELPQRQIW 143

Query: 126 GVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDC 182
           GVD+  +A ++A+SNA    + + RF  L   WF  ++    F +IVSNPPYIE      
Sbjct: 144 GVDLKSEAQQLAQSNAKALKLHNTRF--LAGSWFEPIDDGTEFALIVSNPPYIEKEDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L     GL+  + IA     +L K G    E GY Q   V  +  S 
Sbjct: 202 TRGDVR-FEPLSALVADEKGLADIKHIATQARSYLAKQGWLMFEHGYEQGEAVRELLISL 260

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               V  +KDYG NDRV +
Sbjct: 261 GYDQVATYKDYGDNDRVTI 279


>gi|115375811|ref|ZP_01463063.1| methyltransferase, HemK family [Stigmatella aurantiaca DW4/3-1]
 gi|310822928|ref|YP_003955286.1| hypothetical protein STAUR_5696 [Stigmatella aurantiaca DW4/3-1]
 gi|115367199|gb|EAU66182.1| methyltransferase, HemK family [Stigmatella aurantiaca DW4/3-1]
 gi|309396000|gb|ADO73459.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 292

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 121/241 (50%), Gaps = 7/241 (2%)

Query: 21  QVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETEL 80
           ++ VD D  L   +       I R +  E    + G ++FYN    + +    PRPETEL
Sbjct: 44  RLYVDLDRPLSKEELAAYRALIERRMAGEPTQYLTGAKEFYNRPFKVDARVLIPRPETEL 103

Query: 81  LVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSN 140
           LV++AL  +LP   K      LD+  G+G + ++L  E P    +  D+S  A  +A+ N
Sbjct: 104 LVEAAL-RALP---KDAPSHALDVCAGSGCIAISLAAERPQTSVLATDLSPGACALAREN 159

Query: 141 AVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDG 198
           A T GVS R   LQ D F+ V  +  F ++VSNPPYI S  +  L +EVR  +P ++LDG
Sbjct: 160 AETLGVSSRVTFLQGDLFAPVPADARFALVVSNPPYIASGEIPGLSVEVRR-EPHLALDG 218

Query: 199 GIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           G DGL   R +  G  R+L   GL ++EIG  Q   V  +  +         KD    DR
Sbjct: 219 GRDGLDLIRRVIQGARRYLAPGGLLAMEIGETQGAAVKELLHAAGYSDARVEKDLERRDR 278

Query: 259 V 259
           +
Sbjct: 279 L 279


>gi|258592987|emb|CBE69298.1| Putative protein methyltransferase hemK modifies release factors
           RF-1 and RF-2 [NC10 bacterium 'Dutch sediment']
          Length = 297

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 134/276 (48%), Gaps = 17/276 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   +   +G+   Q I+DP+  +   +   L + + R    E +  ILG ++F+++ L
Sbjct: 16  DAAYLMEAASGIPRWQFILDPEQPIPLDRSGLLESMVSRREAREPVAYILGVKEFWSLLL 75

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-----------VRILDLGTGTGAVCLA 114
            +S D   PRP+TE LV++AL     + +  +            + I+DLGTG GAV LA
Sbjct: 76  AVSPDVLIPRPDTETLVETALDKISVKCQGSETQHSTLNTRHSQLVIVDLGTGCGAVALA 135

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW---FSSVE--GLFDVIV 169
           L  E P      +D S  A  IA  N  T G++ R   +Q D    F +++  G  D+IV
Sbjct: 136 LAVELPRALIYAIDRSPGACRIAGRNIDTLGLTNRVRCVQGDLLEPFRTIDAGGGCDLIV 195

Query: 170 SNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGY 229
           SNPPYI S     L  E+  ++P  ++DGG DGL +YR I +    +L   G    E+G 
Sbjct: 196 SNPPYIPSAACRVLAPEITAYEPVEAIDGGPDGLRYYRRIIEAAPAYLRDGGWLVFEVGD 255

Query: 230 NQKVDVVRIFESRKLF-LVNAFKDYGGNDRVLLFCR 264
            Q   V+ +    + F      +D  G DRV+   R
Sbjct: 256 GQASAVMELIRKTEGFGPAEVRQDMAGRDRVVCAPR 291


>gi|170683182|ref|YP_001743982.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli SMS-3-5]
 gi|218699919|ref|YP_002407548.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI39]
 gi|170520900|gb|ACB19078.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia coli SMS-3-5]
 gi|218369905|emb|CAR17680.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Escherichia coli IAI39]
          Length = 277

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLAHVTGKGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDCMPDAVSLAQRNA-QNLAIKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|325122702|gb|ADY82225.1| methyl transferase [Acinetobacter calcoaceticus PHEA-2]
          Length = 271

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 112/216 (51%), Gaps = 10/216 (4%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP     +   I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEILVETVLNLNLP-----NTANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDV 167
           GA+ LAL  E P +     DI    LE+AK NA  + + +R       WF ++E   FD+
Sbjct: 118 GAIALALASERPDWFVTATDIYVPTLEVAKENAQVHNL-QRVKFACGAWFDALEPQKFDL 176

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E 
Sbjct: 177 IVSNPPYIDP---EDEHMQALATEPRRALVADHQGLADIEIIIAQGKDWLKPQGWIALEH 233

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           GY+Q   V  IF       +   +DYG NDRV L C
Sbjct: 234 GYDQGQAVRNIFAEHGFSEIRTIQDYGQNDRVTLAC 269


>gi|148546008|ref|YP_001266110.1| HemK family modification methylase [Pseudomonas putida F1]
 gi|148510066|gb|ABQ76926.1| modification methylase, HemK family [Pseudomonas putida F1]
          Length = 276

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 114/214 (53%), Gaps = 8/214 (3%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  ILG + F+ + L ++  T  PRP+TELLV++AL      ++     ++LDLGTGT
Sbjct: 65  EPVAYILGLQGFWKIDLEVAPHTLIPRPDTELLVETAL-----ELQPASPAKVLDLGTGT 119

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDV 167
           GA+ LAL  E P ++   VD   +A  +A+ N    G++     L S WF S+ G  FD+
Sbjct: 120 GAIALALASERPAWQVTAVDRVEEAAALAERNRQRLGLANARVRL-SHWFDSLAGERFDL 178

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI +     +  +VR F+P  +L  G DGL   R IA     HL   G   +E 
Sbjct: 179 IVSNPPYIAAEDPHLVAGDVR-FEPSSALVAGADGLDDLRVIAAQAPAHLLPGGWLLLEH 237

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           GY+Q   V  +        V +  D GG++R+ L
Sbjct: 238 GYDQAAAVRALLAEHGFIEVASRTDLGGHERITL 271


>gi|254373463|ref|ZP_04988951.1| hypothetical protein FTCG_01058 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151571189|gb|EDN36843.1| hypothetical protein FTCG_01058 [Francisella novicida GA99-3549]
          Length = 284

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 136/257 (52%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V G+    + ++ D  LD      +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLGVDKAYLYINSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE +V    A  L  I+ +D  ++ILDLGTGTGA+ LAL  E    +
Sbjct: 86  LYVTKDTLIPRADTETVV----ATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
            V VD+  ++L++AK NA  N ++  +F  +QS W+++++   FD+IVSNPPYI+    +
Sbjct: 142 VVAVDLYQQSLDVAKKNAQANNITNVKF--IQSSWYTNLDTDKFDIIVSNPPYIDLADTN 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            +   V+D++P  +L    +GL+  R I       LN  G   +E G+ Q   V  +F  
Sbjct: 200 -IDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAVTALFSQ 258

Query: 242 RKLFLVNAFKDYGGNDR 258
                +   KD   NDR
Sbjct: 259 YNFTHIKTVKDLNNNDR 275


>gi|58584543|ref|YP_198116.1| methylase of polypeptide chain release factor [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418859|gb|AAW70874.1| Methylase of polypeptide chain release factor [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 311

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 7/238 (2%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D V   +++ F      R+ ++  I +I+G R+F++    ++    +PR ++E+LV +AL
Sbjct: 80  DQVSIKKEQLFWKLTKKRAERY-PISQIIGNREFWSKNFIVNRHVLDPRADSEILVSAAL 138

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
            +  P   K+  + I D GTGTG + +++L E     GVG + S KA ++A  N   + +
Sbjct: 139 KY-YPN--KKQEMEIADFGTGTGCLLISVLSEYEHAVGVGFEKSLKAYKVACQNMEKHNL 195

Query: 147 SERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHY 206
             R     S W +  +GLFD+I+SNPPYI    +  L  EV+  +P+I+LDGGIDGLS Y
Sbjct: 196 LGRAKMFPSSW-TECKGLFDLIISNPPYIRRDKLKDLQAEVQK-EPKIALDGGIDGLSCY 253

Query: 207 RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
            +I   + R L K+G   +EIG +Q  D+ +I  S +L       D  G  R ++  R
Sbjct: 254 LSIFPILKRCLKKNGFAILEIGEDQN-DIDKIVPSYELAFQEYMYDLAGMKRCIVIKR 310


>gi|229522129|ref|ZP_04411546.1| methylase of polypeptide chain release factors [Vibrio cholerae TM
           11079-80]
 gi|229341054|gb|EEO06059.1| methylase of polypeptide chain release factors [Vibrio cholerae TM
           11079-80]
          Length = 286

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 129/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLSL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|313497100|gb|ADR58466.1| HemK family modification methylase [Pseudomonas putida BIRD-1]
          Length = 276

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 114/214 (53%), Gaps = 8/214 (3%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  ILG + F+ + L ++  T  PRP+TELLV++AL      ++     ++LDLGTGT
Sbjct: 65  EPVAYILGLQGFWKIDLEVAPHTLIPRPDTELLVETAL-----ELQPASPAKVLDLGTGT 119

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDV 167
           GA+ LAL  E P ++   VD   +A  +A+ N    G++     L S WF S+ G  FD+
Sbjct: 120 GAIALALASERPAWQVTAVDRVEEAAALAERNRQRLGLANARVRL-SHWFDSLAGERFDL 178

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI +     +  +VR F+P  +L  G DGL   R IA     HL   G   +E 
Sbjct: 179 IVSNPPYIAAEDPHLVAGDVR-FEPSSALVAGADGLDDLRVIAAQAPAHLLPGGWLLLEH 237

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           GY+Q   V  +        V +  D GG++R+ L
Sbjct: 238 GYDQAAAVRALLAEHGFIEVASRTDLGGHERITL 271


>gi|283850913|ref|ZP_06368199.1| modification methylase, HemK family [Desulfovibrio sp. FW1012B]
 gi|283573836|gb|EFC21810.1| modification methylase, HemK family [Desulfovibrio sp. FW1012B]
          Length = 303

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 113/221 (51%), Gaps = 6/221 (2%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           + R  + E +  +LG R+FY +   ++ DT  PRPETEL+VD ALA         +V   
Sbjct: 82  VARRGRGEPVAYLLGEREFYGLDFRVTPDTLIPRPETELIVDRALAL----FPAGNVAAF 137

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW--FS 159
            DLGTG+G + + L  + P   G+ +D S  AL +A+ NA  +GV++R   +++D+    
Sbjct: 138 ADLGTGSGCLAVTLASKFPAAVGLALDRSPNALAVARENAARHGVADRLAFVEADFAALP 197

Query: 160 SVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNK 219
           + +G + ++VSNPPY+          EVRDF+P  +L  G  GL     +A      L  
Sbjct: 198 ARDGGYGLVVSNPPYVSQAEYGECSREVRDFEPLAALVPGETGLEAVPVVAQAAFDALAP 257

Query: 220 DGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
            G   VEIG+ Q  +   I  +     V   +D  G DRV+
Sbjct: 258 GGWLLVEIGWKQGGEAADILAASGFADVAVRRDLAGCDRVV 298


>gi|167625122|ref|YP_001675416.1| HemK family modification methylase [Shewanella halifaxensis
           HAW-EB4]
 gi|167355144|gb|ABZ77757.1| modification methylase, HemK family [Shewanella halifaxensis
           HAW-EB4]
          Length = 280

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 130/257 (50%), Gaps = 8/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V       +   PD  L+  Q F     + + L+   I  I+G R+F+++  
Sbjct: 26  DAEVMLLHVINKPRSYLYTWPDRSLEPEQVFEFKQMLAKRLRGNPIAHIVGEREFWSLPF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE+LV++AL  +LP  E     ++LDLGTGTGA+ L+L  E   ++  
Sbjct: 86  RVNPTTLIPRPDTEILVETAL--NLPLAEN---AKVLDLGTGTGAIALSLAHERNEWQVC 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
            +D    A+ +AK N   N   E+ D  QSDWF +VE   F++IVSNPPYI+        
Sbjct: 141 AIDKVEDAVALAKVNR-ANLKLEQVDVFQSDWFDAVECYDFNLIVSNPPYIDEEDEHLSQ 199

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L   + G +    IA+    +L   G   +E GY Q +++         
Sbjct: 200 GDVR-FEPQSALTAPLKGFADLFHIAESARDYLAPGGYLLLEHGYQQAIELREKLIELGY 258

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   +D+G NDR  L
Sbjct: 259 ENVATVRDFGSNDRCTL 275


>gi|229528815|ref|ZP_04418205.1| methylase of polypeptide chain release factors [Vibrio cholerae
           12129(1)]
 gi|229332589|gb|EEN98075.1| methylase of polypeptide chain release factors [Vibrio cholerae
           12129(1)]
          Length = 286

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 129/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|166032747|ref|ZP_02235576.1| hypothetical protein DORFOR_02462 [Dorea formicigenerans ATCC
           27755]
 gi|166027104|gb|EDR45861.1| hypothetical protein DORFOR_02462 [Dorea formicigenerans ATCC
           27755]
          Length = 299

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/261 (32%), Positives = 129/261 (49%), Gaps = 14/261 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG+S      +P+  + + +       + +  +   +  I G ++F     
Sbjct: 30  DAWYLLEYVTGISRASYYGNPEKNISEEEAKRYWEYLEKRARRIPLQHITGSQEFMGYEF 89

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK-- 123
            ++     PR +TE LV+ AL    P +       +LD+ TG+G + ++LLK +   K  
Sbjct: 90  LVNEHVLIPRQDTENLVEEALKVIRPDM------HVLDMCTGSGCILISLLKYAAERKHI 143

Query: 124 ----GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVI 179
                VG DIS  ALE+AK NA    V   +  +QSD F +V   FD+IVSNPPYI + +
Sbjct: 144 TGGKAVGADISADALEVAKKNAQRLKVPVIW--VQSDIFENVSESFDLIVSNPPYIRTEV 201

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
           +  L  EV+  DP I+LDG  DGL  YR I      HLN       EIG++Q  DV ++ 
Sbjct: 202 IQGLEDEVKLHDPWIALDGHEDGLYFYRRIVSESISHLNDGAWLMFEIGHDQAEDVSKLM 261

Query: 240 ESRKLFLVNAFKDYGGNDRVL 260
           ++     +   KD  G DRV+
Sbjct: 262 KNAGFCNIYVKKDLAGLDRVV 282


>gi|323351594|ref|ZP_08087248.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           VMC66]
 gi|322122080|gb|EFX93806.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           VMC66]
          Length = 276

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 115/216 (53%), Gaps = 8/216 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H+    I+G  DF+ + L +      PRPETE LV+  L+ +         + +LD+G
Sbjct: 63  LAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSEN-----PESSLSVLDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ LAL    P ++    D+S  AL +A  NA ++G++  F  +QSD   +++G F
Sbjct: 118 TGSGAIALALANSRPDWQITASDLSGDALALAAENAQSSGLNLVF--VQSDCLDAIQGKF 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     D +GL V   +P ++L    DG + YR IA+    +L K G   +
Sbjct: 176 DIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYAVYRKIAEQAGDYLTKIGKIYL 235

Query: 226 EIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
           EIGY Q   V  + E       +   KD  G DR++
Sbjct: 236 EIGYKQGDGVRELLEKNFPQKRIRVLKDQFGKDRMV 271


>gi|298485682|ref|ZP_07003761.1| modification methylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159708|gb|EFI00750.1| modification methylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 277

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAHVLNSHWFSALEGRQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|317495270|ref|ZP_07953640.1| methyltransferase [Gemella moribillum M424]
 gi|316914692|gb|EFV36168.1| methyltransferase [Gemella moribillum M424]
          Length = 280

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 132/234 (56%), Gaps = 14/234 (5%)

Query: 31  DDRQRFFLTNAIVRSLKHES-IHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           +D Q++F    I + +K ++ +  ++G+  FY+ +  ++SD   PR ETE LV   + + 
Sbjct: 49  EDEQKYF--QLINKHIKDDTPLSHLVGFEYFYDRKFKVTSDVLSPRMETEELVYKVIDY- 105

Query: 90  LPRIEKRDV--VRILDLGTGTGAVCLALLKESPFF--KGVGVDISCKALEIAKSNAVTNG 145
              I K ++  +++LDL TG+G + + L KE   F  K +  DIS +AL +AK NA +  
Sbjct: 106 ---IRKNNLTNIKVLDLCTGSGIIGITLKKELEEFDVKILASDISSRALTVAKENASSLE 162

Query: 146 VSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSH 205
               F  ++SD FS+++  FD+IVSNPPYI       +   V ++DP ++L    +G+  
Sbjct: 163 ADISF--VESDLFSNIQDKFDIIVSNPPYIAHDDKKTIKENVLNYDPHLALFADEEGMYF 220

Query: 206 YRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRV 259
           YR I +    +LN+ G+   EIGY+QK  ++ + E+ K F    +KD  G DR+
Sbjct: 221 YRNIIEKSRPYLNEKGIMFFEIGYDQKEKIITLGENNK-FETVVYKDINGRDRI 273


>gi|315222985|ref|ZP_07864864.1| protein-(glutamine-N5) methyltransferase [Streptococcus anginosus
           F0211]
 gi|315187935|gb|EFU21671.1| protein-(glutamine-N5) methyltransferase [Streptococcus anginosus
           F0211]
          Length = 276

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 136/260 (52%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVT-GLSSHQVI--VDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           +S SF  R++  LS  Q +  +  ++  DD +   L     + L H     I+G  +F+ 
Sbjct: 22  ESLSFTFRISKNLSFTQFVLKMQAEATADDIE--LLKKIQSQLLVHRPAQYIIGNAEFHG 79

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
               +      PRPETE LV+  L+ + P       +++LD+GTG+GA+ L+L  E   +
Sbjct: 80  HSFKVDERVLIPRPETEELVNLILSEN-PNTN----IKVLDIGTGSGAIALSLATERSNW 134

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
           +    DIS  AL++A+ NA    V+   D +QSD F ++ G +D+IVSNPPYI     + 
Sbjct: 135 QVTASDISQDALDLAQENAEAIDVA--IDFVQSDCFQAITGKYDIIVSNPPYISETDREE 192

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +GL V   +P ++L    DG + YR IA+   +HL + G   +EIGY Q   V  +F+S 
Sbjct: 193 VGLNVLASEPHLALFAEEDGYAVYRKIAENAQKHLTEKGKIYLEIGYKQGEHVKELFQSA 252

Query: 243 -KLFLVNAFKDYGGNDRVLL 261
                +   +D  G DR+++
Sbjct: 253 FPKMRIRVLQDQFGKDRMVV 272


>gi|261209905|ref|ZP_05924206.1| Polypeptide chain release factor methylase [Vibrio sp. RC341]
 gi|260841091|gb|EEX67616.1| Polypeptide chain release factor methylase [Vibrio sp. RC341]
          Length = 286

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 127/260 (48%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L++     L   + R +  E I  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEEPALASLDALLARRMAGEPIAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  +V   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALVDGELLDLGTGTGAIALALASELPQRR 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A  +A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAALAQENATRLAI-HNTQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+      L   G    E GY+Q   V  +   
Sbjct: 199 LSQGDVR-FEPQSALVAKENGLADIRYISTHAPHFLLDGGWLLFEHGYDQGAAVQMMLRE 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                V   +DY GNDRV L
Sbjct: 258 LGYQNVTTEQDYAGNDRVTL 277


>gi|169795524|ref|YP_001713317.1| methyl transferase [Acinetobacter baumannii AYE]
 gi|213158535|ref|YP_002319833.1| protein methylase, HemK family [Acinetobacter baumannii AB0057]
 gi|215483011|ref|YP_002325216.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter baumannii AB307-0294]
 gi|301344981|ref|ZP_07225722.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter baumannii AB056]
 gi|301513509|ref|ZP_07238746.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter baumannii AB058]
 gi|301597422|ref|ZP_07242430.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter baumannii AB059]
 gi|332850712|ref|ZP_08432959.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6013150]
 gi|332866987|ref|ZP_08437304.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6013113]
 gi|169148451|emb|CAM86317.1| methyl transferase [Acinetobacter baumannii AYE]
 gi|213057695|gb|ACJ42597.1| protein methylase, HemK family [Acinetobacter baumannii AB0057]
 gi|213988463|gb|ACJ58762.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Acinetobacter baumannii AB307-0294]
 gi|332730549|gb|EGJ61865.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6013150]
 gi|332734316|gb|EGJ65444.1| protein-(glutamine-N5) methyltransferase [Acinetobacter baumannii
           6013113]
          Length = 271

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 115/217 (52%), Gaps = 12/217 (5%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP+        I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLNLNLPK-----NANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-GLFD 166
           GA+ LAL  E P +     DI    L++AK NA T+G+   +F      WF ++E   FD
Sbjct: 118 GAIALALASERPDWFVTATDIYAPTLDVAKENAQTHGLHHVKFAC--GAWFEALEPQQFD 175

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           +IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E
Sbjct: 176 LIVSNPPYIDP---EDEHMQALATEPRRALVADHHGLADIEIIIAQGKNWLKPQGWIALE 232

Query: 227 IGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
            GY+Q   V  IF       + + +DYG NDRV L C
Sbjct: 233 HGYDQGQAVRGIFAEHGFSEIKSIQDYGRNDRVTLAC 269


>gi|32475816|ref|NP_868810.1| hemK protein [Rhodopirellula baltica SH 1]
 gi|32446359|emb|CAD76187.1| hemK protein [Rhodopirellula baltica SH 1]
          Length = 296

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 130/259 (50%), Gaps = 5/259 (1%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L    G    ++    D V ++ QR      + R  +   + +++G+R+FY++ +
Sbjct: 34  DAEILLAHARGCQRIELYTSFDKVPEEEQRVAFRELVRRRGEGAPVAQLVGYREFYSISI 93

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +  +   PRPETE LV  A+     R+  R    +LD+GTG+GA+ +A+ K  P  +  
Sbjct: 94  RVDENVLVPRPETEHLVIEAIDQIKGRLSDRPSPTVLDIGTGSGAIAVAIAKSLPKTQVT 153

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVDCL 183
            VDIS  AL+IAK N     +S+R   LQSD F  +E    FDVI SNPPYI     D L
Sbjct: 154 AVDISLTALDIAKWNVENLKLSDRVTLLQSDLFDGLEPDQTFDVICSNPPYISQSEYDEL 213

Query: 184 GLEVRDFDPRISLDGGIDGLSHY-RTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              VR+F+PR +L  G DG     R + D V R LN  G   +E+          + E  
Sbjct: 214 PTTVREFEPRGALLSGPDGTEIIARLLNDSVQR-LNDGGQLIIELSPMIAGVSKTLAEQN 272

Query: 243 KLFL-VNAFKDYGGNDRVL 260
             +  ++  KD  G++R+L
Sbjct: 273 GGYKEIHLIKDLAGHERIL 291


>gi|306829485|ref|ZP_07462675.1| protein-(glutamine-N5) methyltransferase [Streptococcus mitis ATCC
           6249]
 gi|304428571|gb|EFM31661.1| protein-(glutamine-N5) methyltransferase [Streptococcus mitis ATCC
           6249]
          Length = 278

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 114/219 (52%), Gaps = 16/219 (7%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H+    I+G  DF+ ++L +      PRPETE LVD  L  +       + ++ILD+GTG
Sbjct: 65  HKPAQYIIGQADFFGMQLKVDERVLIPRPETEELVDLILTEN-----PEESLKILDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDV 167
           +GA+ LAL K  P +     DIS  ALE+A  NA    ++  F   +SD F+ +   +D+
Sbjct: 120 SGAIALALAKNRPDWSVTAADISQVALELASENASNQNLNIFFK--KSDCFAEISEKYDI 177

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI       +GL V   +P ++L    DGL+ YR IA+    +L   G   +EI
Sbjct: 178 IVSNPPYISREDESEVGLNVLHSEPHLALFADEDGLAIYRRIAEDAKDYLTDGGKIYLEI 237

Query: 228 GYNQKVDVVRIF-----ESRKLFLVNAFKDYGGNDRVLL 261
           GY Q   V  +F     E R    V   KD  G DR+++
Sbjct: 238 GYKQGQSVPALFRKHLPEKR----VRTLKDQFGQDRMVV 272


>gi|227890653|ref|ZP_04008458.1| peptide release factor-glutamine N5-methyltransferase
           [Lactobacillus salivarius ATCC 11741]
 gi|227867591|gb|EEJ75012.1| peptide release factor-glutamine N5-methyltransferase
           [Lactobacillus salivarius ATCC 11741]
 gi|300214392|gb|ADJ78808.1| Peptide release factor-glutamine N5-methyltransferase
           [Lactobacillus salivarius CECT 5713]
          Length = 279

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 7/259 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
            L D    +C   G +  Q++++  + +DD+    L   I    +   +  ++G++DFY 
Sbjct: 23  TLEDVDYLICGQMGWNKTQLLMNYRTRIDDKNYQELQEKIELYNQDYPLQYLIGYQDFYG 82

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL ++ DT  PRPETE LVD  L  +     K +   +LD+GTGTGA+ LAL      +
Sbjct: 83  LRLKVTKDTLIPRPETEELVDWILNDN----SKNENYDVLDVGTGTGAIGLALKSIRSNW 138

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
                DIS  AL++AK NA    +   F T  SD F  +EG  D+IVSNPPYI       
Sbjct: 139 NIFLSDISEPALKVAKENAQNLNLDVSFST--SDLFEKIEGKKDIIVSNPPYISENEKIY 196

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ES 241
           +   V +++P  +L    +GL  Y  IA+   + L +     +EIG+ Q   V +IF +S
Sbjct: 197 MDKSVLNYEPHQALFAKNNGLEIYERIANESGKLLKQGSKIYMEIGFLQGKAVKKIFKDS 256

Query: 242 RKLFLVNAFKDYGGNDRVL 260
                +   KD  GNDR++
Sbjct: 257 FPNSEITLKKDINGNDRMI 275


>gi|153213281|ref|ZP_01948693.1| hemK protein [Vibrio cholerae 1587]
 gi|124116081|gb|EAY34901.1| hemK protein [Vibrio cholerae 1587]
          Length = 286

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEKPTLASLDLLLARRRAGEPMAYILGEREFWSLSL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPMRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|254509163|ref|ZP_05121262.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus 16]
 gi|219547914|gb|EED24940.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Vibrio parahaemolyticus 16]
          Length = 286

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 127/258 (49%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +LD  Q     + + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHALDKPRSFLLTWPDKLLDAEQLAQFASLLERRLGGEPVAYIVGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE LV+ AL  +           ILDLGTGTGA+ LAL  E P  +  
Sbjct: 89  DVAPSTLIPRPDTERLVEIALDKA-----SDSEGDILDLGTGTGAIALALASELPNRRVW 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCL 183
           GVD+   A ++A SNA    +    +     WF  +E    F +IVSNPPYIE       
Sbjct: 144 GVDLKEDARQLASSNAKKLNIP-NCEFRSGSWFDPIESGTQFALIVSNPPYIEKSDPHLS 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    +GL+  + I++    HL   G    E GY+Q + V  +  S  
Sbjct: 203 QGDVR-FEPLSALVAEDNGLADIKYISEVARSHLQPGGWLMFEHGYDQGIAVRDLLASLG 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V  FKDYG NDRV +
Sbjct: 262 YDQVETFKDYGNNDRVTI 279


>gi|163847181|ref|YP_001635225.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Chloroflexus aurantiacus J-10-fl]
 gi|222525022|ref|YP_002569493.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Chloroflexus sp. Y-400-fl]
 gi|163668470|gb|ABY34836.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Chloroflexus aurantiacus J-10-fl]
 gi|222448901|gb|ACM53167.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Chloroflexus sp. Y-400-fl]
          Length = 283

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 125/256 (48%), Gaps = 6/256 (2%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  + G S  +V+ + D VL   Q       I R    E +  ++G R+F+ + L
Sbjct: 24  DAELLLAHILGWSRAKVVAERDHVLTPEQEMAFNALIERRANREPVAYLIGHREFFGLDL 83

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +      PRPETELLV+  L  +  R     ++ I D+GTG+GA+ +AL    P     
Sbjct: 84  FVDRRVLIPRPETELLVELTLKEA-QRFNHTPLI-IADIGTGSGAIAIALAMHLPHALIY 141

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
           GVDIS  AL +A  N     + +R   L+ D  + +    D++VSNPPY    I+  +  
Sbjct: 142 GVDISPDALAVAAINVTRYRLDDRIRLLEGDLCTPLPAPVDILVSNPPY---TILTEIDE 198

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ESRKL 244
            V   +P ++LDGG DGL  YR +      +L  +G   +EIG  Q   VV +  ++  +
Sbjct: 199 GVYRHEPHLALDGGSDGLDCYRRLIAAAPTYLKPNGAILLEIGSTQAASVVHLLRQALPM 258

Query: 245 FLVNAFKDYGGNDRVL 260
                 +D  G+DR++
Sbjct: 259 AETGIERDLAGHDRIV 274


>gi|157376590|ref|YP_001475190.1| HemK family modification methylase [Shewanella sediminis HAW-EB3]
 gi|157318964|gb|ABV38062.1| modification methylase, HemK family [Shewanella sediminis HAW-EB3]
          Length = 280

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 122/237 (51%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           PD  L   Q       + R L    I  I+G R+F+++   ++  T  PRP+TE+LV++A
Sbjct: 46  PDERLTSDQVTAFGEMVARRLLGTPIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETA 105

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L   L      D  R+LDLGTGTGA+ L+L  E P ++   VD   +A+ +AK+N     
Sbjct: 106 LNLPL-----ADSARVLDLGTGTGAIALSLAYEKPEWQITAVDKIIEAVALAKANRAHLK 160

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +  + +QSDWF SV    F++IVSNPPYI+         +VR F+P+ +L  G +G +
Sbjct: 161 LPQ-VEIVQSDWFDSVACYDFNLIVSNPPYIDETDEHLSQGDVR-FEPQSALTAGEEGFA 218

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
               IA     +L   G   +E GY Q + + +         V   +D+G NDR  L
Sbjct: 219 DLYHIASCARDYLAPGGYLLLEHGYQQAIQLRKKMIELGYENVATVRDFGSNDRCTL 275


>gi|157962942|ref|YP_001502976.1| HemK family modification methylase [Shewanella pealeana ATCC
           700345]
 gi|157847942|gb|ABV88441.1| modification methylase, HemK family [Shewanella pealeana ATCC
           700345]
          Length = 280

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 129/257 (50%), Gaps = 8/257 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V       +   PD  L+  Q F     + + L+   I  I+G R+F+++  
Sbjct: 26  DAEVMLLHVINKQRSYLYTWPDRSLEPEQVFEFKQMLAKRLRGNPIAHIVGEREFWSLPF 85

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE+LV++AL  +LP  E     ++LDLGTGTGA+ L+L  E   ++  
Sbjct: 86  RVNPTTLIPRPDTEILVETAL--NLPLAES---AKVLDLGTGTGAIALSLAHERSEWQVC 140

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
            +D    A+ +AK N  TN   E+ D  QSDWF +VE   F++IVSNPPYI+        
Sbjct: 141 AIDKVDDAVALAKENR-TNLKLEQVDVFQSDWFDAVECYDFNLIVSNPPYIDEEDEHLSQ 199

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P  +L     G +    IA+    +L   G   +E GY Q +++         
Sbjct: 200 GDVR-FEPASALTAPQRGFADLFYIAESARDYLAPGGYLLLEHGYQQAIELREKLIELGY 258

Query: 245 FLVNAFKDYGGNDRVLL 261
             V   +D+G NDR  L
Sbjct: 259 ENVATVRDFGSNDRCTL 275


>gi|313667605|ref|YP_004047889.1| Hemk protein [Neisseria lactamica ST-640]
 gi|313005067|emb|CBN86499.1| putative Hemk protein [Neisseria lactamica 020-06]
          Length = 273

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 123/240 (51%), Gaps = 19/240 (7%)

Query: 26  PDSVLDDRQRFFLTNAIVRS-LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDS 84
           PD V   RQR    + + +S L  E +  +LGWR+FY  R  ++ +   PRPETE LV++
Sbjct: 41  PDEV---RQR---ADRLAQSRLNGEPVAYLLGWREFYGRRFAVNPNVLIPRPETEHLVEA 94

Query: 85  ALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTN 144
            LA  LP     +  R+ DLGTG+GAV + +  E P       DIS  ALE A+ NA   
Sbjct: 95  VLA-RLP-----ENGRVWDLGTGSGAVAVTVALERPDAFVCASDISPPALETARKNAADL 148

Query: 145 GVSERFDTLQSDWFSS---VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGID 201
           G +  F      WF +    EG +D+IVSNPPYIE+        ++R F+P+I+L    D
Sbjct: 149 GAAVEF--AHGSWFDTDMPSEGKWDIIVSNPPYIENGDEHLSQGDLR-FEPQIALTDFSD 205

Query: 202 GLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           GLS  RT+A G    L + G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 206 GLSCIRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|239628685|ref|ZP_04671716.1| modification methylase [Clostridiales bacterium 1_7_47_FAA]
 gi|239518831|gb|EEQ58697.1| modification methylase [Clostridiales bacterium 1_7_47FAA]
          Length = 328

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 131/264 (49%), Gaps = 14/264 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFF-----LTNAIVRSLKHESIHRILGWRDF 60
           D+   L    G S    +   D  L + +  F         I R  +   +  + G ++F
Sbjct: 58  DARYLLLEAFGQSLASFLAVKDKALPEDEETFSKCRKYEEMIDRRAERIPLQHLTGVQEF 117

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
                 ++     PR +TE LV+  L     + +K     +LD+ TG+G + ++L     
Sbjct: 118 MGFEFYVNEHVLIPRQDTETLVELVL-----KEQKGKDAALLDVCTGSGCIAISLALMGG 172

Query: 121 FFKGVGVDISCKALEIAKSNA--VTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIE 176
           +     +D+S +AL +A  NA  +       F+ ++SD F  +E    +D+IVSNPPYI 
Sbjct: 173 YRDVTALDVSREALAVAARNAQRLLKEHEGEFNLIESDMFERLEPDRRYDIIVSNPPYIP 232

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
           S  ++ L  EVRD++PR++LDG  DGL+ YR +A+G  +HL   G   +EIG++Q   V 
Sbjct: 233 SHDIEGLEPEVRDYEPRMALDGTADGLAFYRILAEGCRKHLCPGGCVYMEIGFDQGQAVS 292

Query: 237 RIFESRKLFLVNAFKDYGGNDRVL 260
           R+FE +    V   KD  G DRV+
Sbjct: 293 RMFEMQGYVQVEVMKDMAGLDRVV 316


>gi|330994787|ref|ZP_08318709.1| methyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329758048|gb|EGG74570.1| methyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 287

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 120/232 (51%), Gaps = 3/232 (1%)

Query: 30  LDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           L D       + + R L HE +  I G   F+++ L +S  T  PR ++E LV++ L   
Sbjct: 56  LTDAAHATFIHMLGRRLNHEPMAYITGQAGFWSLDLAVSPATLIPRADSETLVEAVL-HH 114

Query: 90  LPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER 149
           LP  ++   +R+LD+GTGTG + LA+L E     G+G DI+  A  +A  NA  N ++ R
Sbjct: 115 LP--DRTRALRVLDIGTGTGCLLLAVLAEYGQATGIGTDINPHAARLAAHNAARNALASR 172

Query: 150 FDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTI 209
             TL  +W  +V G FD+++SNPPYI    +  L  +V   +P  +LDGG DGL  YR +
Sbjct: 173 CVTLCCNWADAVRGPFDLVLSNPPYIPHADLAGLMPDVVAHEPARALDGGPDGLVAYRAL 232

Query: 210 ADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           A  +   L   G   +E+G  Q   V  +   R L +     D GG  R L+
Sbjct: 233 AAIMPALLAPGGTAVLELGIGQDRSVPALMRERGLEVAEIRPDLGGIGRALV 284


>gi|312958851|ref|ZP_07773370.1| modification methylase [Pseudomonas fluorescens WH6]
 gi|311286621|gb|EFQ65183.1| modification methylase [Pseudomonas fluorescens WH6]
          Length = 276

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 124/240 (51%), Gaps = 8/240 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRP+TELLVD+A
Sbjct: 42  PEKIVSSEDALTFAGYLQRRRAGEPVAYILGQQGFWKLDLEVAPHTLIPRPDTELLVDAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L   LP        R+LDLGTG+GA+ LAL  E P +    VD   +A+ +A+ N     
Sbjct: 102 LEL-LPATP----TRVLDLGTGSGAIALALASERPAWHVTAVDRVLEAVALAERNRQRLH 156

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           +      L S WFS+++G  +D+I+SNPPYI       +  +VR F+P  +L  G DGL 
Sbjct: 157 LHNAM-VLNSHWFSALQGHRYDLIISNPPYIAENDPHLVAGDVR-FEPASALVAGRDGLD 214

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             R I +    HLN  G   +E GY+Q   V  +  ++    V++  D GG++R+ L  R
Sbjct: 215 DLRLIINEAPAHLNAGGWLLLEHGYDQAEAVRDLLLTQGFEDVHSRIDLGGHERITLGRR 274


>gi|326559213|gb|EGE09644.1| protein methyltransferase HemK [Moraxella catarrhalis 46P47B1]
 gi|326576387|gb|EGE26296.1| protein methyltransferase HemK [Moraxella catarrhalis O35E]
          Length = 295

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 125/229 (54%), Gaps = 10/229 (4%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS-----LPR 92
           +T  I++    + +  + G + F+     +++ T  PR +TE+LV+  L ++     + +
Sbjct: 65  ITAGIMQLSAGKPLAYLTGQQSFWGRHFLVNAHTLIPRADTEILVEIILNYAKAQQKIRQ 124

Query: 93  IEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDT 152
            + +++V ILDLGTGTG + + L  E  F + V VDIS +AL++A+ N   + ++ R   
Sbjct: 125 TDNKNLVNILDLGTGTGCIGITLALELEFAQVVLVDISSEALKVAEQN--NHRLNARCQL 182

Query: 153 LQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADG 212
           LQS W   V G FD+IVSNPPYI+      + L+    +P  +L    DGL+  R I + 
Sbjct: 183 LQSHWLQKVSGQFDIIVSNPPYIKENDEHLVNLK---HEPITALVAAEDGLTDIRHIIET 239

Query: 213 VSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
              +L   GL ++E G++Q   V  ++ S     V   +DYGGNDRV L
Sbjct: 240 GRAYLKDGGLMAIEHGFDQAEAVRNLYLSSGYLDVYTIQDYGGNDRVTL 288


>gi|325129314|gb|EGC52151.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis OX99.30304]
 gi|325135296|gb|EGC57917.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis M0579]
 gi|325201297|gb|ADY96751.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis M01-240149]
 gi|325208917|gb|ADZ04369.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis NZ-05/33]
          Length = 273

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+FY  R T++     PRPETE LV++ LA  LP     +  R+ D
Sbjct: 54  RRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 107

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G   R +     WF +   
Sbjct: 108 LGTGSGAVAVTVALERPDAFVRASDISTPALETARKNAADLGA--RVEFAHGSWFDTDMP 165

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+     L  ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 166 SEGKWDIIVSNPPYIENGDKHLLQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 224

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 225 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|168233806|ref|ZP_02658864.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194470184|ref|ZP_03076168.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194456548|gb|EDX45387.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|205332122|gb|EDZ18886.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 277

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----LKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|323261019|gb|EGA44614.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
          Length = 292

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|206558778|ref|YP_002229538.1| protein methyltransferase HemK [Burkholderia cenocepacia J2315]
 gi|198034815|emb|CAR50683.1| protein methyltransferase HemK [Burkholderia cenocepacia J2315]
          Length = 280

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (49%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L    G +  Q+I   D+ LD    +R+    A  R +  E + +++G R+F+  
Sbjct: 19  DARVLLAHALGWTRTQLITRGDAPLDAAAVERYRALEA--RRVAGEPVAQLVGMREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ D   PRPETELLV++AL      I+      +LDLGTG+GA+ +++  E P  +
Sbjct: 77  PFDVTPDVLIPRPETELLVEAALDA----IDGLPHAAVLDLGTGSGAIAVSIAAERPDAR 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S  AL +A+ NA     ++R       LQSDW+++++    FD IVSNPPYI  
Sbjct: 133 VWALDRSPAALAVAQRNADKLLDAQRPGGPLHWLQSDWYAALDPALAFDAIVSNPPYIAQ 192

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  RTI  G   HL   G   +E GY+Q   V  
Sbjct: 193 HDPHLAQGDLR-FEPRGALTDDADGLSAIRTIVAGAGAHLKPGGTLWIEHGYDQAEAVRA 251

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           I  S     V +  D    +R 
Sbjct: 252 ILVSHGFVAVESLTDLAAIERT 273


>gi|255658856|ref|ZP_05404265.1| protein-(glutamine-N5) methyltransferase [Mitsuokella multacida DSM
           20544]
 gi|260849259|gb|EEX69266.1| protein-(glutamine-N5) methyltransferase [Mitsuokella multacida DSM
           20544]
          Length = 291

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 118/220 (53%), Gaps = 9/220 (4%)

Query: 50  SIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG 109
            + +ILG ++F  +   +++DT  PRP+TE+LV +A+   L  +   + +R  D+GTG+G
Sbjct: 74  PVAQILGEKEFMGLTFKVTADTLVPRPDTEILVQAAVD-RLRAMAGEEPLRFADIGTGSG 132

Query: 110 AVCLALLKESPFFKGV---GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-F 165
           A+CL++L    +  G     VDIS  A  +A+ NA + G+++R      D    + G+ F
Sbjct: 133 AICLSVLH---YLSGTVADTVDISPAARAVAEENAASLGLADRITFHTGDLLQPLSGISF 189

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
             I+SNPPYI    +  L  EVR  +P  +L GG DGL  YR +A+     L   G  + 
Sbjct: 190 AAILSNPPYIPEADIAKLAPEVRLKEPHTALSGGQDGLDFYRRLANEAPAMLVPGGFTAF 249

Query: 226 EIGYNQKVDVVRIFESRKLF-LVNAFKDYGGNDRVLLFCR 264
           E+G +Q  DV  + ++  L        DY G DRV++  R
Sbjct: 250 EVGIHQAGDVADLLKANPLIDRTEILPDYAGIDRVVVGWR 289


>gi|310779237|ref|YP_003967570.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ilyobacter polytropus DSM 2926]
 gi|309748560|gb|ADO83222.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ilyobacter polytropus DSM 2926]
          Length = 376

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 120/234 (51%), Gaps = 10/234 (4%)

Query: 31  DDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSL 90
           ++ ++      I R+   + +  ILG  +F+  +  +      PRPETELLV+  +    
Sbjct: 146 EEEKKLIKEMIIKRARDKKPLQYILGEEEFFGYKFKVDERVLIPRPETELLVEQCIVLM- 204

Query: 91  PRIEKRDVVR--ILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE 148
                 DV    ILD+G G+GA+ + L K+ P  K +GVDIS  ALE+A  N   N V  
Sbjct: 205 -----SDVKTPFILDIGVGSGAISVTLGKKIPTSKVLGVDISDGALEVANQNKELNNVK- 258

Query: 149 RFDTLQSDWFSSVE-GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
               ++SD F +V    FD+IVSNPPYI       L  EV+ ++P+++L    +GL  Y+
Sbjct: 259 NVKFIKSDVFENVSYKEFDMIVSNPPYIPEKEYKILMHEVKKYEPKLALTAEDEGLYFYK 318

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            I    S +L   G+ + E+GYNQ   V  + E  +   +   KDY   +R+++
Sbjct: 319 LITKKASDYLKNGGVLAFEVGYNQAQKVKNMMEDNEFENIVIVKDYHQIERIVI 372


>gi|225870518|ref|YP_002746465.1| methyltransferase [Streptococcus equi subsp. equi 4047]
 gi|225699922|emb|CAW93853.1| putative methyltransferase [Streptococcus equi subsp. equi 4047]
          Length = 282

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 126/248 (50%), Gaps = 19/248 (7%)

Query: 17  LSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRP 76
           L  +Q +   D  L   +R FL  +     +H S   I G   F ++ L + S    PRP
Sbjct: 41  LHQNQEVTSEDQAL--LERIFLALS-----QHVSPQYITGRAYFRDLVLAVDSRVLIPRP 93

Query: 77  ETELLVDSALAFSLPRIEKRDVVR--ILDLGTGTGAVCLALLKESPFFKGVGVDISCKAL 134
           ETE LV+  L       ++ D  R  +LD+GTG+GA+ +AL K  P ++    DIS  AL
Sbjct: 94  ETEELVELIL-------KENDATRKSVLDIGTGSGAIAIALKKARPNWQVTASDISADAL 146

Query: 135 EIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRI 194
            +A SNA+ + V   F+  QSD FS + G FD+IVSNPPYI     D +GL V   +P +
Sbjct: 147 SLAYSNALDHHVEIAFE--QSDLFSKLSGQFDIIVSNPPYIAYEDKDEVGLNVYQSEPHL 204

Query: 195 SLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR-KLFLVNAFKDY 253
           +L    +G S YR I +  S +L   G    EIGY Q   + R+   R     +   KD 
Sbjct: 205 ALFAAENGFSIYRRIIEQASAYLTTSGKLYFEIGYKQGEGLKRLLSKRFPQKRIRVLKDM 264

Query: 254 GGNDRVLL 261
            G +R+++
Sbjct: 265 LGKERMVV 272


>gi|205352557|ref|YP_002226358.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205272338|emb|CAR37218.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|326627617|gb|EGE33960.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 277

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPSGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|170723616|ref|YP_001751304.1| protein-(glutamine-N5) methyltransferase [Pseudomonas putida W619]
 gi|169761619|gb|ACA74935.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pseudomonas putida W619]
          Length = 276

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 122/237 (51%), Gaps = 8/237 (3%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRP+TELLV++A
Sbjct: 42  PERIVSSEDAQTYAGYLHRRRSGEPVAYILGQQGFWKLDLEVAPHTLIPRPDTELLVETA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      ++     ++LDLGTGTGA+ LAL  E P ++   +D   +A+ +A+ N    G
Sbjct: 102 L-----ELQPATPAKVLDLGTGTGAIALALASECPAWQVTALDRVEEAVALAERNRQRLG 156

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           +      L S WFS+++G  FD+I+SNPPYI +        +VR F+P  +L  G DGL 
Sbjct: 157 LGN-VKVLASHWFSALDGERFDLILSNPPYIAAEDPHLAAGDVR-FEPSSALVAGADGLD 214

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
             R I      HL   G   +E GY+Q   V  +   +    V + KD GG++R+ L
Sbjct: 215 DLRLIVGQAPAHLLPGGWLLLEHGYDQAPAVRALLTGQGFIEVASRKDLGGHERISL 271


>gi|153825564|ref|ZP_01978231.1| hemK protein [Vibrio cholerae MZO-2]
 gi|149740715|gb|EDM54814.1| hemK protein [Vibrio cholerae MZO-2]
          Length = 286

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEEN-DP 197

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            L L    F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 198 HLSLGDLRFEPKSALVAAENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|167553920|ref|ZP_02347663.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|168462749|ref|ZP_02696680.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195633874|gb|EDX52226.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|205321752|gb|EDZ09591.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 277

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YTDVETCRDYGGNERV 270


>gi|15672580|ref|NP_266754.1| protoporphyrinogen oxidase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|281491064|ref|YP_003353044.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lactococcus lactis subsp. lactis KF147]
 gi|12723493|gb|AAK04696.1|AE006293_2 protoporphyrinogen oxidase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|281374822|gb|ADA64342.1| Protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lactococcus lactis subsp. lactis KF147]
 gi|326406099|gb|ADZ63170.1| methylase of polypeptide chain release factor [Lactococcus lactis
           subsp. lactis CV56]
          Length = 270

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 123/230 (53%), Gaps = 8/230 (3%)

Query: 32  DRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLP 91
           D++   LT    R  ++E    I+GW +F +++L +      PRPETE LV+  LA +  
Sbjct: 45  DQELKLLTEVSKRLHQNEPPQYIVGWAEFRDLKLKVDERVLIPRPETEELVEMILAEN-- 102

Query: 92  RIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFD 151
              ++D ++ILD+GTG+GA+ ++L +    +     DIS +AL +A  NA  N  +  F 
Sbjct: 103 ---EKDSLKILDIGTGSGAIAISLAQARENWSVKASDISKEALTLAAENAEINQANLEF- 158

Query: 152 TLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIAD 211
            +QSD    +   FD+IVSNPPYI       +   V  ++P ++L     GL+ Y+ IAD
Sbjct: 159 -IQSDVLDKITDSFDIIVSNPPYIAFDETYEMDNSVIKYEPDLALFAENQGLAIYQKIAD 217

Query: 212 GVSRHLNKDGLCSVEIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
               HL  +G   +EIGY Q   V  IF+ +    LV+  +D  G DR++
Sbjct: 218 QAVNHLTDNGKIYLEIGYKQGQAVQAIFQEKFTDKLVSIHQDIFGKDRMI 267


>gi|15602421|ref|NP_245493.1| hypothetical protein PM0556 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|18202825|sp|Q9CN82|HEMK_PASMU RecName: Full=Protein methyltransferase hemK homolog; AltName:
           Full=M.PmuHemKP
 gi|12720822|gb|AAK02640.1| HemK [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 298

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 90/267 (33%), Positives = 134/267 (50%), Gaps = 16/267 (5%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  VT  S   ++   ++VL + +   L   ++R  K E I  ILG + F+++ L +S 
Sbjct: 33  LLQTVTKRSKASILAFSETVLTEVELQQLAQLLMRRAKGEPIAYILGEKAFWSLSLKVSE 92

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDV---VRILDLGTGTG-AVCLALLKESPFFKGV 125
            T  PRP+TE+LV+ AL F+  R+    V   + ILDLGTGTG        + +P  +  
Sbjct: 93  HTLIPRPDTEVLVEHALDFAKQRVTSAHVSGELSILDLGTGTGAIALALAAELTPLTQKC 152

Query: 126 GVDIS-------CKALEIAKSNAVTNGVSERFDTLQSDWFSSV--EGLFDVIVSNPPYIE 176
           G++++        +A+ +AK NA  N +   F  LQS WF ++  E  FD+IVSNPPYI+
Sbjct: 153 GINLNILGVDRIAEAVALAKDNAKQNELKVNF--LQSVWFDALNPEIRFDLIVSNPPYID 210

Query: 177 SVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVV 236
                    +VR F+P  +L    +G +  R I +     L   G   +E G+ Q   V 
Sbjct: 211 KNDPHLTQGDVR-FEPLSALVAAEEGYADIRHIIEQAPLFLKPQGALLLEHGWQQAEKVR 269

Query: 237 RIFESRKLFLVNAFKDYGGNDRVLLFC 263
            IF+      V   KDY GN+RV L C
Sbjct: 270 SIFQKNLWHNVATLKDYSGNERVTLGC 296


>gi|16765116|ref|NP_460731.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|62180339|ref|YP_216756.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161613729|ref|YP_001587694.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167993218|ref|ZP_02574313.1| protein methyltransferase HemK [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168237829|ref|ZP_02662887.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168820513|ref|ZP_02832513.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194443667|ref|YP_002041025.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194735200|ref|YP_002114805.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197265643|ref|ZP_03165717.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198245434|ref|YP_002215370.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|207856718|ref|YP_002243369.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224583735|ref|YP_002637533.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|17865746|sp|P40816|HEMK_SALTY RecName: Full=Protein methyltransferase hemK; AltName:
           Full=M.StyLTHemKP; AltName:
           Full=Protein-(glutamine-N(5)) MTase hemK; AltName:
           Full=Protein-glutamine N-methyltransferase hemK
 gi|16420305|gb|AAL20690.1| putative protoporphyrinogen oxidase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62127972|gb|AAX65675.1| putative protoporphyrinogen oxidase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161363093|gb|ABX66861.1| hypothetical protein SPAB_01454 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402330|gb|ACF62552.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194710702|gb|ACF89923.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197243898|gb|EDY26518.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197289229|gb|EDY28596.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197939950|gb|ACH77283.1| protein methyltransferase HemK [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328672|gb|EDZ15436.1| protein methyltransferase HemK [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205342641|gb|EDZ29405.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|206708521|emb|CAR32842.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|224468262|gb|ACN46092.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261246961|emb|CBG24778.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267993723|gb|ACY88608.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301158299|emb|CBW17798.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312912764|dbj|BAJ36738.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|320085724|emb|CBY95502.1| possible protoporphyrinogen oxidase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224403|gb|EFX49466.1| protein-glutamine-N5 methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322616771|gb|EFY13679.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322620419|gb|EFY17285.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322625679|gb|EFY22498.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322626129|gb|EFY22939.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322633736|gb|EFY30476.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322638890|gb|EFY35583.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322640873|gb|EFY37522.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322644094|gb|EFY40639.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322649165|gb|EFY45603.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322655324|gb|EFY51632.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322660918|gb|EFY57149.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322662785|gb|EFY58992.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322667969|gb|EFY64128.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322674269|gb|EFY70363.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322678550|gb|EFY74608.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322683209|gb|EFY79225.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322686903|gb|EFY82881.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|322714813|gb|EFZ06384.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323130045|gb|ADX17475.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323195207|gb|EFZ80387.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323200202|gb|EFZ85288.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323204530|gb|EFZ89534.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323207353|gb|EFZ92301.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323213948|gb|EFZ98717.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323217338|gb|EGA02057.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323228021|gb|EGA12166.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323231360|gb|EGA15473.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323235800|gb|EGA19879.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323240369|gb|EGA24412.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323245261|gb|EGA29261.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323249066|gb|EGA32986.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323252823|gb|EGA36659.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323254892|gb|EGA38686.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323266734|gb|EGA50220.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323268941|gb|EGA52397.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|326623116|gb|EGE29461.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|332988662|gb|AEF07645.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|256545371|ref|ZP_05472734.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Anaerococcus vaginalis ATCC 51170]
 gi|256398932|gb|EEU12546.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Anaerococcus vaginalis ATCC 51170]
          Length = 263

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 117/209 (55%), Gaps = 8/209 (3%)

Query: 55  LGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLA 114
           +G  +FY + L +      PR ETE+LVD  +       +  +  +ILD+GTG+GA+ LA
Sbjct: 62  IGKWNFYGLDLLVDKRALIPRYETEILVDLIIN------DNSNNKKILDIGTGSGAISLA 115

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPY 174
           L K     K +GVDIS  A+++A  N +   ++   +  +SD FS++E  FD+IVSNPPY
Sbjct: 116 LSKNLKDSKIIGVDISKNAIDLANENKIKLNIN-NVEFKESDIFSNIEEKFDIIVSNPPY 174

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I     + L  ++  ++P+ +L GG DGL  Y+ I       LNK+G   +EIGY+QK  
Sbjct: 175 INKEDFEKLDNKLY-YEPQNALYGGEDGLYFYKKIIKNAKNFLNKNGKIYLEIGYDQKDY 233

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           +  + E      + ++KD+   DR++  C
Sbjct: 234 ISNLLEEYGYKQIKSYKDFNDFDRIIKAC 262


>gi|325131308|gb|EGC54019.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis M6190]
 gi|325137337|gb|EGC59925.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis ES14902]
          Length = 273

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  +LGWR+FY  R  ++ +   PRPETE LV++ LA  LP     +  R+ D
Sbjct: 54  RRLNGEPVAYLLGWREFYGRRFAVNPNVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 107

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  +LE A+ NA   G   R +     WF +   
Sbjct: 108 LGTGSGAVAVTVALERPDAFVRASDISPPSLETARKNAADLGA--RVEFAHGSWFDTDMP 165

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+        ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 166 SEGKWDIIVSNPPYIENGDKHLSQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 224

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 225 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|330961729|gb|EGH61989.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAAVAFAGYLERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFASAQVLDLGTGTGAIGLALANERKQWKVTAVDRVAEAVALAERNRQRLH 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S WFS ++G  FD+I+SNPPY+          +VR F+P  +L  G DGL 
Sbjct: 158 LNNA-EIFESHWFSGLQGRQFDLIISNPPYVPDDDPHLSAGDVR-FEPSSALIAGADGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             R I +    HLN +G   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRAITEQAPAHLNAEGWLLLEHGYDQGAAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|254804125|ref|YP_003082346.1| heme biosynthesis protein [Neisseria meningitidis alpha14]
 gi|254667667|emb|CBA03497.1| heme biosynthesis protein [Neisseria meningitidis alpha14]
          Length = 273

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+FY  R T++     PRPETE LV++ LA  LP     +  R+ D
Sbjct: 54  RRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 107

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G   R +     WF +   
Sbjct: 108 LGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGA--RVEFAHGSWFDTDMP 165

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+     L  ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 166 SEGKWDIIVSNPPYIENGDKHLLQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 224

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 225 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|163815256|ref|ZP_02206633.1| hypothetical protein COPEUT_01416 [Coprococcus eutactus ATCC 27759]
 gi|158449451|gb|EDP26446.1| hypothetical protein COPEUT_01416 [Coprococcus eutactus ATCC 27759]
          Length = 284

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 115/220 (52%), Gaps = 4/220 (1%)

Query: 42  IVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRI 101
           I R    E +  I G ++F       S +   PR +TE+LV++AL  +    +  DV   
Sbjct: 61  IRRRCTREPLQYITGVQNFMGYDFCTSENVLIPRQDTEILVETALNLTKSSQKTLDV--- 117

Query: 102 LDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVT-NGVSERFDTLQSDWFSS 160
           LD+  GTG + ++     P  K    DIS  A+ + + N        ERFD + +D F  
Sbjct: 118 LDMCCGTGCIGISYGLLRPDSKVTLADISGDAIRVTRKNVTKLCDEPERFDVINTDLFGD 177

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
           V+G FD+I+SNPPYI+S +++ L  EVRD +PR++LDG  DGL  YR I     +++  +
Sbjct: 178 VDGQFDLILSNPPYIKSDVIEALMPEVRDNEPRLALDGKADGLYFYRIIVSQAIKYIKDE 237

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           G    EIG +Q  DV  +F       V+  +D   NDRV+
Sbjct: 238 GYVVFEIGNDQAEDVQHLFVDTGYDDVHVVQDLCRNDRVV 277


>gi|118498112|ref|YP_899162.1| HemK family modification methylase [Francisella tularensis subsp.
           novicida U112]
 gi|194323338|ref|ZP_03057122.1| methyltransferase, HemK family [Francisella tularensis subsp.
           novicida FTE]
 gi|118424018|gb|ABK90408.1| modification methylase, HemK family [Francisella novicida U112]
 gi|194322702|gb|EDX20182.1| methyltransferase, HemK family [Francisella tularensis subsp.
           novicida FTE]
          Length = 284

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 136/257 (52%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V G+    + ++ D  LD      +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLGVDKTYLYINSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE +V    A  L  I+ +D  ++ILDLGTGTGA+ LAL  E    +
Sbjct: 86  LYVTKDTLIPRADTETVV----ATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
            V VD+  ++L++AK NA  N ++  +F  +QS W+++++   FD+IVSNPPYI+    +
Sbjct: 142 VVAVDLYQQSLDVAKKNAQANNITNVKF--IQSSWYTNLDTDKFDIIVSNPPYIDLADTN 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            +   V+D++P  +L    +GL+  R I       LN  G   +E G+ Q   +  +F  
Sbjct: 200 -IDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQ 258

Query: 242 RKLFLVNAFKDYGGNDR 258
                +   KD   NDR
Sbjct: 259 YNFTDIKTVKDLNNNDR 275


>gi|160916054|ref|ZP_02078261.1| hypothetical protein EUBDOL_02081 [Eubacterium dolichum DSM 3991]
 gi|158431778|gb|EDP10067.1| hypothetical protein EUBDOL_02081 [Eubacterium dolichum DSM 3991]
          Length = 284

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 130/258 (50%), Gaps = 12/258 (4%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
           +L  +T   +H + ++ D  +   Q       + R ++ E +  +LG+  FY  R  ++ 
Sbjct: 28  YLLELTNKEAHNLYMEYDEEMPQAQIDEFEAGVERLVEGEPLGHVLGFEWFYGYRFKVNE 87

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           D   PRPETE LV   LA      +    V  +D+GTG+GA+ +AL KE P    +  DI
Sbjct: 88  DVLIPRPETEELVAYILAAYDEYFKDTLNVTAVDVGTGSGAIAVALKKEEPNIHILASDI 147

Query: 130 SCKALEIAKSNAVTNGVSERF---DTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLE 186
           S KA  IAK NA  N V       D L+     +++   D+++SNPPYI S   + +   
Sbjct: 148 SEKACRIAKQNAQDNDVVVEVLCGDMLEPLIERNIK--VDILISNPPYIPS--DEAMEDS 203

Query: 187 VRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF- 245
           V +++P ++L GG DGL  YR I +   + L    + + E+GYNQK  +    E+RK F 
Sbjct: 204 VVNYEPHVALFGGEDGLKFYRIIFEHAKKVLKDKAMMAFEMGYNQKEALSA--EARKYFP 261

Query: 246 --LVNAFKDYGGNDRVLL 261
              +   KD  G +R+L 
Sbjct: 262 DAKIEVIKDMSGKNRMLF 279


>gi|153828622|ref|ZP_01981289.1| hemK protein [Vibrio cholerae 623-39]
 gi|148875893|gb|EDL74028.1| hemK protein [Vibrio cholerae 623-39]
          Length = 286

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|71735390|ref|YP_273269.1| hemK protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555943|gb|AAZ35154.1| hemK protein [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 120/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRRTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L S WF+++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNSHWFNALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|322387785|ref|ZP_08061394.1| protein-(glutamine-N5) methyltransferase [Streptococcus infantis
           ATCC 700779]
 gi|321141652|gb|EFX37148.1| protein-(glutamine-N5) methyltransferase [Streptococcus infantis
           ATCC 700779]
          Length = 278

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 134/258 (51%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCR-VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +S SF+ R +  LS    +        + ++ F+     +   H     I+G  +F+ ++
Sbjct: 22  ESLSFVYRSLKNLSFTDFVFTLQQEATEEEKQFVEEIYKKLAAHIPAQYIIGHAEFFGMQ 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +      PR ETE LV+  LA +L     +D +++LD+GTG+GA+ LAL K  P +  
Sbjct: 82  LKVDERVLIPRLETEELVELILAENL-----KDNLKVLDIGTGSGAIALALAKNRPDWSV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
              DIS +AL+++  NA    ++  F  ++SD FS +   +D+IVSNPPYI       +G
Sbjct: 137 TAADISQEALDLSLENANAQNLNLSF--IKSDCFSEISAKYDIIVSNPPYISRADEVEVG 194

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-ESRK 243
           L V   +P ++L    DGL+ YR IA+    +LN  G   +EIGY Q   V  +F E+  
Sbjct: 195 LNVLHSEPHLALFADEDGLAIYRRIAEDSKDYLNDGGKIYLEIGYKQGQSVPALFMENFP 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   KD  G DR+++
Sbjct: 255 EKRVRTLKDQFGQDRMVV 272


>gi|325133243|gb|EGC55909.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis M13399]
 gi|325139388|gb|EGC61928.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis CU385]
 gi|325201113|gb|ADY96568.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis H44/76]
          Length = 273

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+FY  R T++     PRPETE LV++ LA  LP     +  R+ D
Sbjct: 54  RRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 107

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G   R +     WF +   
Sbjct: 108 LGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGA--RVEFAHGSWFDTDMP 165

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+     L  ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 166 SEGKWDIIVSNPPYIENGDKHLLQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 224

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 225 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 265


>gi|171319080|ref|ZP_02908204.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia ambifaria MEX-5]
 gi|171095719|gb|EDT40675.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia ambifaria MEX-5]
          Length = 280

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 132/262 (50%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L    G +  Q+I   D+ L+    +R+    A  R +  E + +++G R+F+  
Sbjct: 19  DARVLLAHAFGWTRTQLITRGDAPLEPASIERYRALEA--RRVAGEPVAQLVGMREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ D   PRPETELLV++AL      I+ R    +LDLGTG+GA+ +++  E P  +
Sbjct: 77  PFDVTPDVLIPRPETELLVEAALDA----IDGRPHPAVLDLGTGSGAIAVSIAAERPDAR 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S  AL++A+ NA     + R       LQSDW+++++    FD IVSNPPYI  
Sbjct: 133 VWALDRSPAALDVARRNADKLLDARRPGGALHWLQSDWYAALDPALAFDTIVSNPPYIAQ 192

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  RTI  G   +L   G   +E GY+Q   V  
Sbjct: 193 HDPHLAQGDLR-FEPRGALTDDADGLSAIRTIVAGAGAYLKPGGTLWIEHGYDQAEAVRA 251

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  SR    V +  D    +R 
Sbjct: 252 LLVSRGFVAVESLADLAAIERT 273


>gi|308050534|ref|YP_003914100.1| (protein release factor)-glutamine N5-methyltransferase [Ferrimonas
           balearica DSM 9799]
 gi|307632724|gb|ADN77026.1| (protein release factor)-glutamine N5-methyltransferase [Ferrimonas
           balearica DSM 9799]
          Length = 279

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 116/225 (51%), Gaps = 9/225 (4%)

Query: 38  LTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRD 97
           L   + R    E +  + G R+F+++ L +++ T  PRP+TE LV++AL   LP     D
Sbjct: 56  LAGLLARRQAGEPVAHLTGQREFWSLPLKVNATTLIPRPDTESLVEAALELGLP-----D 110

Query: 98  VVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDW 157
              ++DLGTGTGA+ LAL  E P ++   VD    A+ +A++N  +  +          W
Sbjct: 111 DAEVVDLGTGTGAIALALKSEQPGWRISAVDRIADAVALARAN--SEALDLPITVHHGSW 168

Query: 158 FSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
           F  + G  FD+IVSNPPYI+         +VR F+PR +L     GL+  R +A+  + H
Sbjct: 169 FEPLSGQRFDLIVSNPPYIDPQDPHLGQGDVR-FEPRSALTADDHGLADIRHLAEAAANH 227

Query: 217 LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           L   G+  VE G++Q   V  IF    L  V   +D G  +R  L
Sbjct: 228 LRAGGVLMVEHGWDQGEAVREIFRQAGLTSVRTGRDLGNRERFTL 272


>gi|114046305|ref|YP_736855.1| HemK family modification methylase [Shewanella sp. MR-7]
 gi|113887747|gb|ABI41798.1| modification methylase, HemK family [Shewanella sp. MR-7]
          Length = 286

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 128/254 (50%), Gaps = 8/254 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+  FL      S   +   P+  L   Q       + R  +   +  I+G R+F+++  
Sbjct: 28  DAEVFLLYCLNKSRAFLYTWPEKALTVEQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPF 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE+LV++AL   L         ++LDLGTGTGA+ LAL  E   ++  
Sbjct: 88  IVNDTTLIPRPDTEILVETALNLPL-----ESNAKVLDLGTGTGAIALALASERATWQIT 142

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
            VD   +A+ +AK+N  TN   E+ + LQSDWFS+++   FD+IVSNPPYI+        
Sbjct: 143 AVDKVEEAVALAKANR-TNLKLEQVEILQSDWFSAIKAHDFDLIVSNPPYIDEADEHLHQ 201

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L    +G +    IA     +L  +G   +E G+ Q V +         
Sbjct: 202 GDVR-FEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLREKLTELGY 260

Query: 245 FLVNAFKDYGGNDR 258
             V   +D+G NDR
Sbjct: 261 QNVATVRDFGSNDR 274


>gi|261821676|ref|YP_003259782.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pectobacterium wasabiae WPP163]
 gi|261605689|gb|ACX88175.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pectobacterium wasabiae WPP163]
          Length = 281

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 10/259 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   V+   ++ L   ++  LT  + R    E I  ++G R+F+++ 
Sbjct: 22  RDAEILLGFVTGKSRTFVLAFGETELRAAEQQQLTELLARRELGEPIAYLIGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ AL   LP    +    +LDLGTGTGA+ LA+  E      
Sbjct: 82  LVVSPATLIPRPDTECLVEQAL-LRLP----KKPCDVLDLGTGTGAIALAIASERHDCLV 136

Query: 125 VGVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDC 182
           VGVD+  +A+ +A  NA    + + RF  L   W+S +E   F +I SNPPYI++  V  
Sbjct: 137 VGVDLQPEAVALATKNAQQLRLDNARF--LPGSWYSPLEHRRFALIASNPPYIDADDVHL 194

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L    +GL+  R I +    +L   G   +E G+ Q   V ++ ++R
Sbjct: 195 SQGDVR-FEPASALVAADNGLADLRIIIESAPHYLEVGGWLLLEHGWQQGDAVRQLLQAR 253

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +   +DYGGNDRV L
Sbjct: 254 GFTQLETCQDYGGNDRVSL 272


>gi|261253597|ref|ZP_05946170.1| Polypeptide chain release factor methylase [Vibrio orientalis CIP
           102891]
 gi|260936988|gb|EEX92977.1| Polypeptide chain release factor methylase [Vibrio orientalis CIP
           102891]
          Length = 286

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (49%), Gaps = 9/258 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +LD +Q     + + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHALDKPRSFLLTWPDKILDAQQLAAFDDLLQRRLTGEPVAYIVGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  ++    + D   ILDLGTGTGA+ LAL  E P  +  
Sbjct: 89  KVSPTTLIPRPDTERLVEIALDKAM----QMD-GDILDLGTGTGAIALALASELPQRQVT 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCL 183
           G+D+   A ++A+SNA    +S     L   WF  +     F +IVSNPPYIE       
Sbjct: 144 GIDLKQDAQQLAQSNASALNLSNT-QFLAGSWFEPLAAGTEFALIVSNPPYIEKEDPHLT 202

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     GL+  + IA     +L   G    E G+ Q   V  +  S  
Sbjct: 203 QGDVR-FEPLSALVADEKGLADIKHIATQARDYLMDSGWLMFEHGFEQGEPVRELLRSLG 261

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V  +KDYG NDRV +
Sbjct: 262 YDQVATYKDYGDNDRVTI 279


>gi|300939552|ref|ZP_07154209.1| protein-(glutamine-N5) methyltransferase [Escherichia coli MS 21-1]
 gi|300455556|gb|EFK19049.1| protein-(glutamine-N5) methyltransferase [Escherichia coli MS 21-1]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGRGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDCMPDAVSLAQRNA-QNLAIKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|237799728|ref|ZP_04588189.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022583|gb|EGI02640.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLERRRAGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFASAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRKRLH 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +  + L S+WFS+++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAEVLDSNWFSALQGRQFDLIISNPPYIADADPHLAAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             R I      HLN +G   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLREIIRQAPTHLNAEGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|317048555|ref|YP_004116203.1| release factor-specific protein-(glutamine-N5) methyltransferase
           [Pantoea sp. At-9b]
 gi|316950172|gb|ADU69647.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Pantoea sp. At-9b]
          Length = 276

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 131/262 (50%), Gaps = 16/262 (6%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG S   ++   D++LDD Q   L   + R  + E I  ++G R+F+++ 
Sbjct: 22  RDAEILLAFVTGKSRSWLVAFDDALLDDVQLQQLATLLARRAQGEPIAHLVGEREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE+LV+ ALA  LP         ILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LRVSDATLIPRPDTEVLVEQALAH-LPAT----AATILDLGTGTGAIALALASERPDCQV 136

Query: 125 VGVDISCKALEIAKSNA----VTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVI 179
            G D    A+ +A+ NA    +TN          S WF+++    FD+I SNPPYI++  
Sbjct: 137 TGCDRVEAAVALAQDNAQRLHITN-----VQFFLSHWFAALPSQRFDLIASNPPYIDAAD 191

Query: 180 VDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF 239
                 +VR F+P  +L     GL+  R I       L   G   +E G+ Q   V  + 
Sbjct: 192 HHLQQGDVR-FEPLSALVAEEAGLADLREIITTAPAWLLPGGWLLLEHGWQQGEAVRTLM 250

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
             +    VN   DYGGN RV L
Sbjct: 251 TQQGYQQVNTVDDYGGNPRVTL 272


>gi|189485188|ref|YP_001956129.1| methylase of polypeptide chain release factors [uncultured Termite
           group 1 bacterium phylotype Rs-D17]
 gi|170287147|dbj|BAG13668.1| methylase of polypeptide chain release factors [uncultured Termite
           group 1 bacterium phylotype Rs-D17]
          Length = 288

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 125/232 (53%), Gaps = 7/232 (3%)

Query: 30  LDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFS 89
           L D Q       I+R  K E +  I+G   F +    ++ +   PRPETE+LV++AL  +
Sbjct: 53  LTDIQVLQYERYILRRSKREPVAYIMGLAGFMDFEFKVNKNVLIPRPETEILVETALKIA 112

Query: 90  LPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSER 149
               +K +   +LDL TG+G + ++L K   F   +  D+S  ALEIA+ NA +N V + 
Sbjct: 113 ----KKENKNSVLDLCTGSGCIAVSLAKLGKFKDIMASDVSGSALEIARENARSNNVLD- 167

Query: 150 FDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRT 208
            + ++S+ FS + G  FD+I+SNPPY+     D L  E++ ++P I+L     GL  Y+ 
Sbjct: 168 INFVKSNVFSGISGKNFDIIISNPPYVSHEEYDALEPELK-YEPEIALAADDSGLFFYKK 226

Query: 209 IADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVL 260
           IA    R+LN +G   +E+   +  ++ +IF +     +   KDY G  R+L
Sbjct: 227 IAGKAGRYLNDNGFILIELNAYKAGEIKQIFSTCSYKNIEIVKDYAGLPRML 278


>gi|200389878|ref|ZP_03216489.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|199602323|gb|EDZ00869.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 277

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|167464537|ref|ZP_02329626.1| modification methylase, HemK family protein [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322383118|ref|ZP_08056945.1| glutamine methylase of release factor 1-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321152780|gb|EFX45406.1| glutamine methylase of release factor 1-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 293

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 115/219 (52%), Gaps = 5/219 (2%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R    E +  ILG +DFY +   ++     PRPETELLV+  + +   R+  +    + D
Sbjct: 68  RKAGGEPVQYILGEQDFYGLPFEVNKAVLIPRPETELLVERII-YEGKRLFPQGSPLLGD 126

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWF-SSVE 162
           +GTG+GA+ + L    P ++    D+S  ALE+A+ NAV NGV +R   LQ D     VE
Sbjct: 127 IGTGSGAIPVTLAHACPEWRVYSSDLSPLALEVARRNAVRNGVGDRVTLLQGDLLLPYVE 186

Query: 163 -GL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            GL  D++VSNPPYI +  +  L  EVR F+P  +L GG DGL  YR + D +     + 
Sbjct: 187 RGLPIDILVSNPPYIPTGDLPALQPEVRQFEPHTALFGGPDGLDLYRRMMDQLGSLPKQP 246

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLF-LVNAFKDYGGNDR 258
            L  +E+G  Q  DV  +      +  V   KD  G DR
Sbjct: 247 ALVGLEVGIGQADDVANLLRGAGDWSSVEYVKDLAGIDR 285


>gi|241895237|ref|ZP_04782533.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Weissella paramesenteroides ATCC 33313]
 gi|241871543|gb|EER75294.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Weissella paramesenteroides ATCC 33313]
          Length = 286

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 123/239 (51%), Gaps = 8/239 (3%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKH-ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           ++VL+D +R     A VR++K  + +   LG   FY     +      PR ETE LV+  
Sbjct: 53  NTVLEDEKRLRFMVA-VRAIKGGQPVQYALGHAAFYGREFQVDRRVLIPRQETEELVEWV 111

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           LA      E+     +LD+GTG+GA+ ++L  E   +  VG DIS +AL +AK NA    
Sbjct: 112 LADHPTNTEQH----VLDMGTGSGAIAVSLSAERTSWAVVGADISEEALAVAKENAQLYA 167

Query: 146 VSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSH 205
            S +   LQSD F+ V G FD+IV+NPPYI       +   V  F+P I+L    DGL+ 
Sbjct: 168 PSVQL--LQSDLFTGVTGSFDIIVANPPYISRNEQSLMDESVVMFEPDIALYADDDGLAL 225

Query: 206 YRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
           Y+ +A  +   L   G    EIGY Q   +V +F +    +V   +D  G+DR++   R
Sbjct: 226 YKKMATDLLTFLKPGGAAYFEIGYQQGEKLVDLFSTLPHVIVTLRQDLSGHDRMIKVLR 284


>gi|208779476|ref|ZP_03246821.1| methyltransferase, HemK family [Francisella novicida FTG]
 gi|208744437|gb|EDZ90736.1| methyltransferase, HemK family [Francisella novicida FTG]
          Length = 284

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 136/257 (52%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V G+    + ++ D  LD      +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLGVDKAYLYINSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE +V    A  L  I+ +D  ++ILDLGTGTGA+ LA+  E    +
Sbjct: 86  LYVTKDTLIPRADTETVV----ATVLDDIQNKDAQLKILDLGTGTGAIALAIAAELANSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
            V VD+  ++L++AK NA  N ++  +F  +QS W+++++   FD+IVSNPPYI+    +
Sbjct: 142 VVAVDLYQQSLDVAKKNAQANNITNVKF--IQSSWYTNLDTDKFDIIVSNPPYIDLADTN 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            +   V+D++P  +L    +GL+  R I       LN  G   +E G+ Q   +  +F  
Sbjct: 200 -IDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFVYIEHGFTQADAIKALFSQ 258

Query: 242 RKLFLVNAFKDYGGNDR 258
                +   KD   NDR
Sbjct: 259 YNFTHIKTVKDLNNNDR 275


>gi|238913675|ref|ZP_04657512.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
          Length = 277

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAVFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|307265647|ref|ZP_07547200.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389250|ref|ZP_08210818.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter ethanolicus JW 200]
 gi|306919291|gb|EFN49512.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994613|gb|EGD53037.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 279

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 116/216 (53%), Gaps = 9/216 (4%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H     I+  + F  +   +  +   PRPETE+LV+  L     R+E+ +V  ILD+GTG
Sbjct: 66  HIPYQYIVKKQHFMGLEFFVDENVLIPRPETEILVEEVLK----RVERGNV--ILDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LF 165
           +GA+ +++ K         VDIS KA+E+AK NA   GV +R   ++SD F ++     F
Sbjct: 120 SGAIAVSISKYFADCTVYAVDISKKAIEVAKYNAEKQGVLDRIFFIESDLFRNLPPNLKF 179

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D IVSNPPYI+   ++ L  EV+  +P ++LDGG DGL  Y+ I      ++   G    
Sbjct: 180 DFIVSNPPYIKRNEIELLQEEVKK-EPIVALDGGEDGLFFYKKIIKEAPFYMKSGGKIGF 238

Query: 226 EIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           EIGY QK ++    E      +   KD  G DRV++
Sbjct: 239 EIGYGQKEEITNFLEKDGFKDIEIIKDLAGIDRVII 274


>gi|269798158|ref|YP_003312058.1| modification methylase, HemK family [Veillonella parvula DSM 2008]
 gi|269094787|gb|ACZ24778.1| modification methylase, HemK family [Veillonella parvula DSM 2008]
          Length = 289

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 123/218 (56%), Gaps = 9/218 (4%)

Query: 47  KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGT 106
           K   +  I+G +DF  +   ++     PRP+TE L++  L  + P   K   +RILD+ T
Sbjct: 71  KGHCVAAIIGEKDFMGLTFKVNDKVLIPRPDTETLIEHVLG-TYP---KDSNLRILDVCT 126

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--- 163
           G G + L+LL   P   GVG+DIS  AL +A+ N  +  +S+R   ++SD F ++ G   
Sbjct: 127 GPGTILLSLLHYLPNSSGVGLDISTDALPVARENGESFNLSDRVQFMESDMFHTLYGKKE 186

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI +  +  L  +V + +P I+L GG DGL  YR +A     +LN +G  
Sbjct: 187 KFDLIVSNPPYIRTGDLKMLSPDVLN-EPHIALFGGEDGLQFYRILAKECRNYLNANGRV 245

Query: 224 SVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           + E+G++Q  +V  +  E+ +   ++   D GG +RV+
Sbjct: 246 AFEVGFDQAEEVGALLQETGQYSNIHFIADLGGYNRVV 283


>gi|330941683|gb|EGH44458.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 277

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R  K E +  ILG + F+ + L ++  T  PRPETE LV++A
Sbjct: 42  PERIVSTEAAVAFAGYMERRRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEKLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L      +      ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LEL----VPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           ++   +  +S W S ++G  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 LNN-AEVFESHWLSGLQGRQFDLIISNPPYISDADPHLSAGDVR-FEPSSALVAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI +    HLN DG   +E GY+Q   V  +   +    +   +D G ++R+   C+
Sbjct: 216 DLRTIIEQAPAHLNVDGWLLLEHGYDQGPAVRELLIRQGFERIQTRRDLGEHERITFGCK 275


>gi|294792025|ref|ZP_06757173.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella sp. 6_1_27]
 gi|294457255|gb|EFG25617.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Veillonella sp. 6_1_27]
          Length = 289

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 123/218 (56%), Gaps = 9/218 (4%)

Query: 47  KHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGT 106
           K   +  I+G +DF  +   ++     PRP+TE L++  L  + P   K   VRILD+ T
Sbjct: 71  KGHCVAAIIGEKDFMGLTFKVNDKVLIPRPDTETLIEHVLG-TYP---KDSNVRILDVCT 126

Query: 107 GTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG--- 163
           G G + L+LL   P   GVG++IS  AL +A+ N     +++R   L+SD FS++ G   
Sbjct: 127 GPGTILLSLLHYLPNACGVGLEISIDALLVAEENGERFNLNDRVQFLESDMFSALAGNAE 186

Query: 164 LFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLC 223
            FD+IVSNPPYI +  V  L  +V + +P I+L GG DGL  YR +A     +LN +G  
Sbjct: 187 KFDLIVSNPPYIRTGDVKLLSQDVLN-EPHIALFGGEDGLEFYRILAKECRNYLNANGRV 245

Query: 224 SVEIGYNQKVDVVRIF-ESRKLFLVNAFKDYGGNDRVL 260
           + E+G++Q  +V  +  E+ +   +    D GG++RV+
Sbjct: 246 AFEVGFDQAKEVGALLQETGQYSNIQFIADLGGHNRVV 283


>gi|301299953|ref|ZP_07206180.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300852435|gb|EFK80092.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 279

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 130/259 (50%), Gaps = 7/259 (2%)

Query: 3   ALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
            L D    +C   G    Q++++  + +DD+    L   I    +   +  ++G++DFY 
Sbjct: 23  TLEDVDYLICGQMGWDKTQLLMNYRTRIDDKNYQELQEKIELYNQDYPLQYLIGYQDFYG 82

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           +RL ++ DT  PRPETE LVD  L  +     K +   +LD+GTGTGA+ LAL      +
Sbjct: 83  LRLKVTKDTLIPRPETEELVDWILNDN----SKNENYDVLDVGTGTGAIGLALKSIRSNW 138

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
                DIS  AL++AK NA    +   F T  SD F  +EG  D+IVSNPPYI       
Sbjct: 139 NIFLSDISEPALKVAKENAQNLNLDVSFST--SDLFEKIEGKKDIIVSNPPYISENEKIY 196

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           +   V +++P  +L    +GL  Y  IA+   + L +     +EIG+ Q   V +IF+  
Sbjct: 197 MDKSVLNYEPHQALFAKNNGLEIYERIANESGKLLKQGSKIYMEIGFLQGEAVKKIFKDN 256

Query: 243 -KLFLVNAFKDYGGNDRVL 260
                +   KD  GNDR++
Sbjct: 257 FPNSEITLKKDINGNDRMI 275


>gi|260779384|ref|ZP_05888276.1| Polypeptide chain release factor methylase [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260605548|gb|EEX31843.1| Polypeptide chain release factor methylase [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 289

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 130/259 (50%), Gaps = 11/259 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  PD +LD          + R +  E +  I G R+F+++ L
Sbjct: 29  DAAVLLCHTLNKPRSFLLTWPDKILDSEAILAFEANLQRRINGEPVAYITGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE LV+ AL  ++      +   ILDLGTGTGA+ LA+  E P  +  
Sbjct: 89  KVAPSTLIPRPDTERLVEIALEKAV-----ENQGDILDLGTGTGAIALAIASELPNRQVW 143

Query: 126 GVDISCKALEIAKSNAVTNGV-SERFDTLQSDWFSSV--EGLFDVIVSNPPYIESVIVDC 182
           GVD+  +A ++A+SNA   G+ + +F  L   WF  V     F +IVSNPPYIE      
Sbjct: 144 GVDLKQEAKQLAESNAEHLGIRNTQF--LSGSWFEPVGTGTKFALIVSNPPYIEEHDPHL 201

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
              +VR F+P  +L    +GL+  + I+      L  DG    E GY+Q + V  I  S 
Sbjct: 202 AQGDVR-FEPLSALVAKDNGLADIKHISSQALSFLQCDGWLMFEHGYDQGMAVREILGSL 260

Query: 243 KLFLVNAFKDYGGNDRVLL 261
               +  +KDYG NDRV +
Sbjct: 261 GYQNITTYKDYGENDRVTI 279


>gi|291547176|emb|CBL20284.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ruminococcus sp. SR1/5]
          Length = 295

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 124/244 (50%), Gaps = 14/244 (5%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           + V D+    +LT  I R   H  + ++     F      ++ +   PR +TE LV+ AL
Sbjct: 48  EPVSDETAAEYLT-LIDRRAGHIPVQQLTHQAFFMGYEFYVNENVLIPRQDTETLVEEAL 106

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
              L  +EK +   ILD+ TG+G + L+LL E     G GVD+S +ALE+AK NA    V
Sbjct: 107 K-HLGNVEKPE---ILDMCTGSGCILLSLLLERQDACGTGVDVSPEALEVAKKNAGILKV 162

Query: 147 SERFDTLQSDWFSSV---------EGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLD 197
             R D ++SD FS+           G +D+++SNPPYI +  ++ L  EVR  DPR +LD
Sbjct: 163 ENRADFVESDLFSAPYFCEKGGKDSGKYDILISNPPYIATEEIETLMEEVRLHDPRKALD 222

Query: 198 GGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGND 257
           G  DGL  YR I     R+L   G    EIG  Q   V  + ++     V   KD  G D
Sbjct: 223 GMEDGLYFYRKITAEAGRYLKPGGWLLYEIGCTQGEAVSTMMKAAGFTGVQIVKDLPGLD 282

Query: 258 RVLL 261
           RV+L
Sbjct: 283 RVVL 286


>gi|17547622|ref|NP_521024.1| methyltransferase [Ralstonia solanacearum GMI1000]
 gi|17429926|emb|CAD16610.1| probable methylase of polypeptide chain release factors protein
           [Ralstonia solanacearum GMI1000]
          Length = 306

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 126/260 (48%), Gaps = 15/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   +  VTGLS  Q+I      +DD  R  L     R L  E +  +LG R+F+    
Sbjct: 42  EARMLVSHVTGLSRVQLITQDTCGIDDGTRTRLAELATRRLAGEPMAYLLGEREFFGRMF 101

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTG--AVCLALLKESPFFK 123
            ++     PRP+TELLV+ AL     RI+ RD   +LDLGTG+G  AV +AL +     +
Sbjct: 102 QVTPAVLIPRPDTELLVEQALD----RIDDRDAPAVLDLGTGSGIIAVTIALARRD--AR 155

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV-----EGLFDVIVSNPPYIESV 178
               D S  AL +A  NA   G +     L  DW++++       +FD+IVSNPPYI S 
Sbjct: 156 VWATDTSADALAVAVRNAQALGAANMHAAL-GDWYAALPESDAPPVFDLIVSNPPYIAST 214

Query: 179 IVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRI 238
                  ++R F+P  +L    DGL H RTI  G    L  DG   +E GY+Q   V  +
Sbjct: 215 DAHLGQGDLR-FEPAGALTDHGDGLRHLRTIVAGAPARLAADGWLLLEHGYDQGPAVRAL 273

Query: 239 FESRKLFLVNAFKDYGGNDR 258
                   V   +D  G+DR
Sbjct: 274 LADAGFADVFTAQDLTGHDR 293


>gi|309800292|ref|ZP_07694465.1| HemK protein [Streptococcus infantis SK1302]
 gi|308116076|gb|EFO53579.1| HemK protein [Streptococcus infantis SK1302]
          Length = 278

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 119/217 (54%), Gaps = 12/217 (5%)

Query: 48  HESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTG 107
           H     I+G  +F+ ++L +      PRPETE LV+  LA +       + +++LD+GTG
Sbjct: 65  HIPAQYIIGHAEFFGMQLEVDERVLIPRPETEELVELILAEN-----PEENLKVLDIGTG 119

Query: 108 TGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDV 167
           +GA+ LAL K  P +     DIS  AL++A  NA   G++  F  ++S+ FS +   +D+
Sbjct: 120 SGAIALALAKNRPDWTITAADISQDALDLAMENADNLGLTLFF--IKSNCFSEISSKYDI 177

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI  V    +GL V   +P ++L    DGL+ YR IA+    +LN  G   +EI
Sbjct: 178 IVSNPPYISRVDEAEVGLNVLHSEPHLALFADEDGLAIYRRIAEESKDYLNDGGKIYLEI 237

Query: 228 GYNQKVDVVRIFESRKLFL---VNAFKDYGGNDRVLL 261
           GY Q   V  +F  +K F    V   KD  G DR+++
Sbjct: 238 GYKQGQSVPALF--KKNFPEKRVRTLKDQFGQDRMVV 272


>gi|294101725|ref|YP_003553583.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Aminobacterium colombiense DSM 12261]
 gi|293616705|gb|ADE56859.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Aminobacterium colombiense DSM 12261]
          Length = 286

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 133/267 (49%), Gaps = 11/267 (4%)

Query: 2   QALRDSHSFLCRVTGLS-SHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           +A  ++  FLC +  +S S  +++  +  L + +   L   + R +  E +  I+G+  F
Sbjct: 26  RAESETEWFLCSLKEISRSRFLLIASEVYLTEEEVISLNQMVQRRISGEPLQYIIGYESF 85

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           +     +      PRPETEL+V+ AL + +           LD GTG+G +   +L E P
Sbjct: 86  WGRDFLVGPGCLIPRPETELVVEEALRYFVKG-------SFLDWGTGSGCIAATILAERP 138

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNPPYIES 177
             +GV +++S +A+E A  N     +  R     S   S +       D+I+SNPPYI +
Sbjct: 139 LSRGVAIEVSPQAIEWAWKNLRRYNLLHRCLLWHSREMSDIPVPSQSLDLIISNPPYIPT 198

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
             +  L  EV  ++P ++LDGG DGL +Y+ +       L   G+  VE+G + + +V+ 
Sbjct: 199 AAIGRLMKEVAGYEPYVALDGGEDGLLYYKELLHVAPIWLKPGGMLVVELGDSTQGEVLA 258

Query: 238 IFESRKLFLVNAFKDYGGNDRVLLFCR 264
            + +  L L+   KD+ G  R+ ++CR
Sbjct: 259 NYNALGLRLMKLAKDFQGIYRIAVWCR 285


>gi|168260000|ref|ZP_02681973.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|205350947|gb|EDZ37578.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
          Length = 277

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRFG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YTDVETCRDYGGNERV 270


>gi|331008867|gb|EGH88923.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 277

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 120/240 (50%), Gaps = 7/240 (2%)

Query: 26  PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSA 85
           P+ ++           + R    E +  ILG + F+ + L ++  T  PRPETE+LV++A
Sbjct: 42  PERIVSTEAALAFAGYLQRRCTGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAA 101

Query: 86  LAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNG 145
           L  + P        ++LDLGTGTGA+ LAL  E   +K   VD   +A+ +A+ N     
Sbjct: 102 LELA-PAFAP---AKVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERNRQRLQ 157

Query: 146 VSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLS 204
           + +    L   WFS++EG  FD+I+SNPPYI          +VR F+P  +L  G DGL 
Sbjct: 158 L-DNAQVLNRHWFSALEGQQFDLIISNPPYIADADPHLSAGDVR-FEPSSALTAGSDGLD 215

Query: 205 HYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             RTI      HL+ DG   +E GY+Q   V  +        +   +D G ++R+   C+
Sbjct: 216 DLRTIIADAPVHLSADGWLLLEHGYDQGPAVRELLIRHGFERIQTRRDLGEHERITFGCK 275


>gi|251789677|ref|YP_003004398.1| modification methylase, HemK family [Dickeya zeae Ech1591]
 gi|247538298|gb|ACT06919.1| modification methylase, HemK family [Dickeya zeae Ech1591]
          Length = 283

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 131/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  +TG     ++   ++ L D +   L + + R +  E I  ++G+R+F+++ 
Sbjct: 22  RDAEILLEHITGKGRTFLLAFGETELMDSEYQTLESLLARRVTGEPIAYLIGYREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP         ++DLGTGTGA+ LA+  E P  + 
Sbjct: 82  LAVSPVTLIPRPDTECLVEHALAH-LP----AGASSVVDLGTGTGAIALAIAHERPDCRV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCL 183
           VGVD    A+ +A  NA    ++     L  DWFS + G  F +IVSNPPYI+       
Sbjct: 137 VGVDRQHDAVVLASHNARRLEINNA-QFLPGDWFSPLAGQRFSLIVSNPPYIDEHDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L    DGL+  R I       L  DG   +E G+ Q   V  +     
Sbjct: 196 RGDVR-FEPASALVAAEDGLADLRQIIRQAGTFLLDDGWLLLEHGWQQGQAVRALLSQYG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V  ++DYG N+RV L
Sbjct: 255 FAQVKTYRDYGDNERVTL 272


>gi|87124890|ref|ZP_01080737.1| SAM (and some other nucleotide) binding motif protein
           [Synechococcus sp. RS9917]
 gi|86167210|gb|EAQ68470.1| SAM (and some other nucleotide) binding motif protein
           [Synechococcus sp. RS9917]
          Length = 299

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 118/222 (53%), Gaps = 12/222 (5%)

Query: 46  LKHESIHRILG---WRDFYNVRLTLSSDTFEPRPETELLVDSALA---FSLPRIEKRDVV 99
           L+HE +  ++G   WRD     LT+S+    PR ETE LVD AL     + P    + ++
Sbjct: 73  LQHEPLQHLVGRCPWRDL---ELTVSAAALIPRQETESLVDLALERWRAAQPGASPQPLL 129

Query: 100 RILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFS 159
           R  DLGTG+GA+ +AL +  P   G  VD S  AL +A+ N   +GVS R      DW+ 
Sbjct: 130 RWADLGTGSGALAVALARAFPQASGHAVDCSEAALALARLNLERHGVSARCTLHSGDWWQ 189

Query: 160 SVE---GLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRH 216
            +    GL  +++SNPPYI S +VD L   VR+ +PR++LDGG DGL+  R I  G    
Sbjct: 190 PLRPWWGLLQLVLSNPPYIPSAVVDQLDPVVREHEPRLALDGGADGLAATRLIVAGAPEA 249

Query: 217 LNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDR 258
           L   G   +E  ++Q   V+ +  +  L  + A  D+ G  R
Sbjct: 250 LAPGGWLLIEHHHDQSAAVLDLCAAAGLDHLKAETDWQGVRR 291


>gi|297582071|ref|ZP_06943990.1| hemK protein [Vibrio cholerae RC385]
 gi|297533766|gb|EFH72608.1| hemK protein [Vibrio cholerae RC385]
          Length = 286

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD  L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKTLEKPTLASLELLLARRRAGEPMAYILGEREFWSLSL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAIHNAL-FLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+    R L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAEENGLADIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|239817176|ref|YP_002946086.1| modification methylase, HemK family [Variovorax paradoxus S110]
 gi|239803753|gb|ACS20820.1| modification methylase, HemK family [Variovorax paradoxus S110]
          Length = 283

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 121/256 (47%), Gaps = 12/256 (4%)

Query: 6   DSHSFLCRVTGLSSHQ---VIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYN 62
           D+   L    G + H    ++      L D     L+  + R L  E +  +LG ++F+ 
Sbjct: 27  DAQLLLLHALGRAPHDRAWLLAHDTDTLSDAAWSALSAQLPRRLAGEPVAYLLGEKEFHG 86

Query: 63  VRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFF 122
           + L + +    PRP+TE LVD    ++L  +E RD  R+LDLGTG+GA+ LAL    P  
Sbjct: 87  LGLQVDARVLVPRPDTETLVD----WALQCLEGRDAPRVLDLGTGSGAIALALQHARPDA 142

Query: 123 KGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDC 182
               VD S  AL +A++NA   G+  RF   Q+ W     G + VI SNPPYI +     
Sbjct: 143 LVDAVDASADALAVAEANAQRLGLPVRFR--QAHWLDGAAGGYAVIASNPPYIAAGDPHL 200

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
             L+    +P  +L  G DGL+  R I      HL   G   +E G++Q   V ++  +R
Sbjct: 201 AALQ---HEPLAALVAGPDGLADIRQIVQQAPAHLADGGWLLLEHGHDQAAAVRQLLGAR 257

Query: 243 KLFLVNAFKDYGGNDR 258
               V +  D  G  R
Sbjct: 258 GFAEVQSRDDLAGIQR 273


>gi|15677887|ref|NP_275055.1| hemK protein [Neisseria meningitidis MC58]
 gi|7227327|gb|AAF42384.1| hemK protein [Neisseria meningitidis MC58]
          Length = 423

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+FY  R T++     PRPETE LV++ LA  LP     +  R+ D
Sbjct: 204 RRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 257

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G   R +     WF +   
Sbjct: 258 LGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGA--RVEFAHGSWFDTDMP 315

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+     L  ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 316 SEGKWDIIVSNPPYIENGDKHLLQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 374

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 375 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 415


>gi|168491916|ref|ZP_02716059.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus pneumoniae CDC0288-04]
 gi|183573762|gb|EDT94290.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus pneumoniae CDC0288-04]
          Length = 279

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 121/239 (50%), Gaps = 16/239 (6%)

Query: 28  SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA 87
            V  + ++ F+ +   +   H+    I+G  DFY + L +      PRPETE LV+  L 
Sbjct: 46  EVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILT 105

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
            +L        + +LD+GTG+GA+ LAL K  P +     D+S +ALE+A  NA    ++
Sbjct: 106 ENL-----ETNLSVLDIGTGSGAIALALAKNRPAWSVTAADVSQEALELASENASDQNLN 160

Query: 148 ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
             F   +SD F+ +   +D+IVSNPPYI       +GL V   +P ++L    DGL+ Y 
Sbjct: 161 IFFK--KSDCFAEISEKYDIIVSNPPYISREDESEVGLNVLHSEPHLALFADEDGLAIYC 218

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF-----ESRKLFLVNAFKDYGGNDRVLL 261
            IA+  + +L   G   +EIGY Q   V  +F     E R    V   KD  G DR+++
Sbjct: 219 RIAEDATDYLKDSGKIYLEIGYKQGQSVPELFRKHLPEKR----VRTLKDQFGQDRMVV 273


>gi|291550092|emb|CBL26354.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Ruminococcus torques L2-14]
          Length = 312

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 134/265 (50%), Gaps = 10/265 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  VTG++  +  +DPD  +D          + +   H  +  I G ++F  +  
Sbjct: 43  DAWYLLEFVTGITKARYYMDPDQSMDPEAWKKYKEYLEKRRNHIPLQHITGSQEFMGLEF 102

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRI-EKRDVVRILDLGTGTGAVCLALL----KESP 120
            ++     PR +TE+LV+ AL      I   +  +++LD+ TG+G + L+++    ++  
Sbjct: 103 LVNEHVLIPRQDTEVLVEEALEMMKQEIFRSKGCLQLLDMCTGSGCILLSVMHYAEQKGI 162

Query: 121 FFKGVGVDISCKALEIAKSN-----AVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYI 175
           F +G GVD S +AL +A+ N     +     + + + + SD F +V   +D+I+SNPPYI
Sbjct: 163 FIEGTGVDFSEQALMVAQKNEKHLRSTKKDENGKVNWILSDLFENVSETYDMILSNPPYI 222

Query: 176 ESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDV 235
            +  ++ L  EV+  DP  +LDG  DGL  YR I     + L   G+ + EIGY+Q  +V
Sbjct: 223 RTAEIEKLQDEVKLHDPFSALDGKEDGLYFYRKIVTDAKQFLKTGGILAFEIGYDQGKEV 282

Query: 236 VRIFESRKLFLVNAFKDYGGNDRVL 260
             + +      V   KD  G DR++
Sbjct: 283 SDLMKKAGYDKVFVKKDLAGLDRIV 307


>gi|212697118|ref|ZP_03305246.1| hypothetical protein ANHYDRO_01684 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212675893|gb|EEB35500.1| hypothetical protein ANHYDRO_01684 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 263

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 120/209 (57%), Gaps = 8/209 (3%)

Query: 55  LGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLA 114
           +G  +FY + L +      PR ETE+LVD  +   +    K+D  +ILD+G+G+GA+ LA
Sbjct: 62  IGKWNFYGLDLLVDKRALIPRYETEILVDLIINDKV----KKD--KILDIGSGSGAISLA 115

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPY 174
           L       K +GVDIS  A+ ++  N   N   +  +  +SD FS+VEG FD+IVSNPPY
Sbjct: 116 LSYNLKNSKVLGVDISKDAINLSNENK-KNLSIKNVEFKESDIFSNVEGKFDIIVSNPPY 174

Query: 175 IESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVD 234
           I     + L  ++  ++P+ +L GG DGL  YR I     + LNK+G   +EIGY+QK  
Sbjct: 175 INKEDFENLDKKLS-YEPQNALLGGDDGLFFYRKIILNAKKFLNKNGKIYLEIGYDQKNP 233

Query: 235 VVRIFESRKLFLVNAFKDYGGNDRVLLFC 263
           ++++ +      + A+KD+   DR++  C
Sbjct: 234 IIKLLKEEGYKDIRAYKDFNDFDRIIKAC 262


>gi|307706537|ref|ZP_07643344.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus mitis SK321]
 gi|307617992|gb|EFN97152.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus mitis SK321]
          Length = 278

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (49%), Gaps = 17/262 (6%)

Query: 6   DSHSFLCR-VTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           +S SF+ R +  LS    +      ++  ++ F+     +   H+    I+G  DFY ++
Sbjct: 22  ESLSFVYRSLKNLSFTDFVFALQQEVNKEEKQFVKGIFQQLAAHKPAQYIIGQTDFYGMQ 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           LT+      PRPETE LV   LA + P       + +LD+GTG+GA+ LAL K  P +  
Sbjct: 82  LTVDERVLIPRPETEELVGLILAEN-PETN----LSVLDIGTGSGAIALALAKNRPDWSV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
              DIS  AL++A  NA    +  +    +SD F+ +   +D+IVSNPPYI       +G
Sbjct: 137 TAADISQDALDLANENAKNQNL--QIFLKKSDCFTEISEKYDIIVSNPPYISREDESEVG 194

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIF----- 239
           L V   +P ++L    DGL+ YR IA+    +L   G   +EIGY Q   V  +F     
Sbjct: 195 LNVLHSEPHLALFADEDGLAIYRRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLP 254

Query: 240 ESRKLFLVNAFKDYGGNDRVLL 261
           E R    V   KD  G DR+++
Sbjct: 255 EKR----VRTLKDQFGQDRMVV 272


>gi|121635723|ref|YP_975968.1| hemk protein [Neisseria meningitidis FAM18]
 gi|120867429|emb|CAM11201.1| hemk protein [Neisseria meningitidis FAM18]
          Length = 423

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  +LGWR+FY  R  ++ +   PRPETE LV++ LA  LP     +  R+ D
Sbjct: 204 RRLNGEPVAYLLGWREFYGRRFAVNPNVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 257

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  +LE A+ NA   G   R +     WF +   
Sbjct: 258 LGTGSGAVAVTVALERPDAFVRASDISPPSLETARKNAADLGA--RVEFAHGSWFDTDMP 315

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+        ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 316 SEGKWDIIVSNPPYIENGDKHLSQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 374

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 375 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 415


>gi|84394466|ref|ZP_00993180.1| HemK protein [Vibrio splendidus 12B01]
 gi|84374907|gb|EAP91840.1| HemK protein [Vibrio splendidus 12B01]
          Length = 290

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 127/272 (46%), Gaps = 25/272 (9%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC         ++  P+  L   Q       + R L  E +  I+G R+F+++ L
Sbjct: 29  DAAVLLCHALDKPRSYLLTWPEKHLTSEQESEFHTLLKRRLTGEPVAYIVGEREFWSLPL 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S  T  PRP+TE LV+ AL  +  +        ILDLGTGTGA+ LAL  E P     
Sbjct: 89  KVSPSTLIPRPDTERLVEVALDKTYGKQGA-----ILDLGTGTGAIALALASEMPNRPVT 143

Query: 126 GVDISCKALEIAKSNA----VTNGVSERFDTLQSDWFSSVEGL--------FDVIVSNPP 173
           G+D+  +A ++A  NA    +TN        L   WF  +           F +IVSNPP
Sbjct: 144 GIDLRPEAQQLATENAQRLNITNAT-----FLHGSWFEPLNSASSEEEAVKFSLIVSNPP 198

Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233
           YIE         +VR F+P  +L     GL+  R I++     L  +G  + E GY+Q +
Sbjct: 199 YIEKNDPHLSQGDVR-FEPITALVAEEKGLADIRYISENARDFLENEGWLAFEHGYDQGL 257

Query: 234 DVVRIFESRKLFLVNAFKDYGGNDRVLL--FC 263
            V  I +      V   KDYGGNDRV L  +C
Sbjct: 258 AVREIMQQLGYLDVVTEKDYGGNDRVTLGRYC 289


>gi|332678839|gb|AEE87968.1| modification methylase, HemK family [Francisella cf. novicida Fx1]
          Length = 255

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 135/251 (53%), Gaps = 10/251 (3%)

Query: 11  LCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSD 70
           +C V G+    + ++ D  LD      +   I+R L  E +  ILG++ F+N +L ++ D
Sbjct: 3   ICDVLGVDKTYLYINSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKD 62

Query: 71  TFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFKGVGVDI 129
           T  PR +TE +V    A  L  I+ +D  ++ILDLGTGTGA+ LAL  E    + V VD+
Sbjct: 63  TLIPRADTETVV----ATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQVVAVDL 118

Query: 130 SCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCLGLEV 187
             ++L++AK NA  N ++  +F  +QS W+++++   FD+IVSNPPYI+    + +   V
Sbjct: 119 YQQSLDVAKKNAQANNITNVKF--IQSSWYTNLDTDKFDIIVSNPPYIDLADTN-IDQSV 175

Query: 188 RDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLV 247
           +D++P  +L    +GL+  + I       LN  G   +E G+ Q   V  +F       +
Sbjct: 176 KDYEPARALFAADNGLADIKIIISQAKDFLNPRGFIYIEHGFTQADAVTALFSQYNFTHI 235

Query: 248 NAFKDYGGNDR 258
              KD   NDR
Sbjct: 236 KTVKDLNNNDR 246


>gi|260554586|ref|ZP_05826807.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           protein [Acinetobacter baumannii ATCC 19606]
 gi|260411128|gb|EEX04425.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           protein [Acinetobacter baumannii ATCC 19606]
          Length = 273

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 114/215 (53%), Gaps = 12/215 (5%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  + G + F+ + L ++SDT  PRP+TE+LV++ L  +LP+        I+DLGTGT
Sbjct: 63  EPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLNLNLPK-----NANIVDLGTGT 117

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVE-GLFD 166
           GA+ LAL  E P +     DI    L++AK NA T+G+   +F      WF ++E   FD
Sbjct: 118 GAIALALASERPDWFVTATDIYAPTLDVAKENAQTHGLHHVKFAC--GAWFEALEPQQFD 175

Query: 167 VIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVE 226
           +IVSNPPYI+    +   ++    +PR +L     GL+    I       L   G  ++E
Sbjct: 176 LIVSNPPYIDP---EDEHMQALATEPRRALVADHHGLADIEIIIAQGKNWLKPQGWIALE 232

Query: 227 IGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
            GY+Q   V  +F +     +   +DYG NDRV L
Sbjct: 233 HGYDQGQAVRNVFAAHGFSEIKTIQDYGQNDRVTL 267


>gi|284921024|emb|CBG34089.1| protein methyltransferase hemk (protein-glutamine N
           methyltransferase) [Escherichia coli 042]
          Length = 277

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGGREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVSLAQRNA-QNLAIKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|168241357|ref|ZP_02666289.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|194447419|ref|YP_002045818.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194405723|gb|ACF65942.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|205339433|gb|EDZ26197.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
          Length = 277

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 133/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L + + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLADLLQRRKQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V  +F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAVFRRFG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YTDVETCRDYGGNERV 270


>gi|148984975|ref|ZP_01818218.1| HemK protein [Streptococcus pneumoniae SP3-BS71]
 gi|147922673|gb|EDK73790.1| HemK protein [Streptococcus pneumoniae SP3-BS71]
 gi|301799987|emb|CBW32577.1| putative methyltransferase [Streptococcus pneumoniae OXC141]
          Length = 279

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 120/237 (50%), Gaps = 12/237 (5%)

Query: 28  SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA 87
            V  + ++ F+ +   +   H+    I+G  DFY + L +      PRPETE LV+  L 
Sbjct: 46  EVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILT 105

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
            +L        + +LD+GTG+GA+ LAL K  P +     D+S +AL++A  NA    + 
Sbjct: 106 ENL-----ETNLSVLDIGTGSGAIALALAKNRPDWSVTAADVSQEALDLANENAKNQNLQ 160

Query: 148 ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
             F   +SD F+ +   +D+IVSNPPYI       +GL V   +P ++L    DGL+ YR
Sbjct: 161 IFFK--KSDCFTEISEKYDIIVSNPPYISREDESEVGLNVLYSEPHLALFADEDGLAIYR 218

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVLL 261
            IA+    +L   G   +EIGY Q   V  +F  RK      V   KD  G DR+++
Sbjct: 219 RIAEDAKDYLKDGGKIYLEIGYKQGQSVPELF--RKHLPEKKVRTLKDQFGQDRMVV 273


>gi|204927633|ref|ZP_03218834.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204322975|gb|EDZ08171.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 277

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 131/256 (51%), Gaps = 8/256 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q+  L   + R  + E I  + G R+F+++ 
Sbjct: 22  RDAEILLEYVTGKGRTYIMAFGETPLTDVQQQQLAELLQRRRQGEPIAYLTGLREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----VKTCRILDLGTGTGAIALALACERPDCEV 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A  NA    +      LQS WFS++ G  FD+IVSNPPYI++      
Sbjct: 137 TAVDRMPDAVALAIRNAEHLAI-RNVRILQSCWFSALSGQQFDMIVSNPPYIDAQDPHLS 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+PR +L    +G++    I D   + L   G   +E G+ Q   V   F    
Sbjct: 196 EGDVR-FEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAFFRRSG 254

Query: 244 LFLVNAFKDYGGNDRV 259
              V   +DYGGN+RV
Sbjct: 255 YSDVETCRDYGGNERV 270


>gi|187931104|ref|YP_001891088.1| modification methylase, HemK family [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187712013|gb|ACD30310.1| modification methylase, HemK family [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 284

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 136/257 (52%), Gaps = 10/257 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
            D    +C V G+    + ++ D  LD      +   I+R L  E +  ILG++ F+N +
Sbjct: 26  HDLQMIICDVLGVDKTYLYINSDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQK 85

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDV-VRILDLGTGTGAVCLALLKESPFFK 123
           L ++ DT  PR +TE +V    A  L  I+ +D  ++ILDLGTGTGA+ LAL  E    +
Sbjct: 86  LYVTKDTLIPRADTETIV----ATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ 141

Query: 124 GVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVD 181
            V VD+  ++L++AK NA  N ++  +F  +QS W+++++   FD+IVSNPPYI+    +
Sbjct: 142 VVAVDLYQQSLDVAKKNAQANNITNVKF--IQSSWYTNLDTDKFDIIVSNPPYIDLADTN 199

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
            +   V+D++P  +L    +GL+  R I       LN  G   +E G+ Q   +  +F  
Sbjct: 200 -IDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQ 258

Query: 242 RKLFLVNAFKDYGGNDR 258
                +   KD   NDR
Sbjct: 259 CNFTDIKIVKDLNNNDR 275


>gi|170731834|ref|YP_001763781.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia cenocepacia MC0-3]
 gi|169815076|gb|ACA89659.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Burkholderia cenocepacia MC0-3]
          Length = 280

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 130/262 (49%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L    G +  Q+I   D+ LD    +R+    A  R +  E + +++G R+F+  
Sbjct: 19  DARVLLAHALGWTRTQLITRGDAPLDAAAIERYRALEA--RRVAGEPVAQLVGTREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ D   PRPETELLV++AL      I+      +LDLGTG+GA+ +++  E P  +
Sbjct: 77  PFDVTPDVLIPRPETELLVEAALDA----IDGLPHAAVLDLGTGSGAIAVSIAAERPDAR 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S  AL +A+ NA     + R       LQSDW+++++    FD IVSNPPYI  
Sbjct: 133 VWALDRSPAALAVAQRNADKLLDARRPGGPLHWLQSDWYAALDPALGFDAIVSNPPYIAQ 192

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  RTI  G S +L   G   +E GY+Q   V  
Sbjct: 193 HDPHLAQGDLR-FEPRGALTDDADGLSAIRTIVAGASAYLKPGGTLWIEHGYDQAEAVRA 251

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           I  S     V +  D    +R 
Sbjct: 252 ILASHGFVAVESLADLAAIERT 273


>gi|159896800|ref|YP_001543047.1| HemK family modification methylase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889839|gb|ABX02919.1| modification methylase, HemK family [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 283

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 136/262 (51%), Gaps = 17/262 (6%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   L  V GL+  Q++   +  L   Q       I R    E I  ++G R+FY +  
Sbjct: 27  DARVLLGHVLGLTQTQILAAFNDQLSTEQVEQFQGLIERRSALEPIAYLIGSREFYGLMF 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +      PRP+TE+LV+ AL +   + ++R +V + D+GTG+G + +A+ K +P  K  
Sbjct: 87  NVDRRVLVPRPDTEILVEQALTWI--KQQQRPLV-VADIGTGSGCIAVAVTKHAPTIKMY 143

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGL 185
            VD+S  AL +A+SN   +G+ ++ + +  D  S +    D+++SNPPY    ++D +  
Sbjct: 144 AVDLSPAALAVAQSNVERHGLQQQIELIHGDGVSQLPEPIDLLLSNPPY---TLLDEIEP 200

Query: 186 EVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV---EIGYNQKVDVVRI---- 238
            VR  +P ++LDGG DGL  YR +    +  L + GL S    EIG  Q  +V+ +    
Sbjct: 201 GVRLHEPTLALDGGPDGLDCYRQLLPATAAIL-RQGLPSAALFEIGAWQGSEVIALAQAS 259

Query: 239 FESRKLFLVNAFKDYGGNDRVL 260
           F   K+ LV   +D    DRV+
Sbjct: 260 FPQAKIQLV---RDLAARDRVV 278


>gi|26987470|ref|NP_742895.1| methyl transferase [Pseudomonas putida KT2440]
 gi|24982134|gb|AAN66359.1|AE016264_3 methyl transferase [Pseudomonas putida KT2440]
          Length = 276

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 113/214 (52%), Gaps = 8/214 (3%)

Query: 49  ESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGT 108
           E +  ILG + F+ + L ++  T  PRP+TELLV++AL      ++     ++LDLGTGT
Sbjct: 65  EPVAYILGLQGFWKIDLEVAPHTLIPRPDTELLVETAL-----ELQPASPAKVLDLGTGT 119

Query: 109 GAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDV 167
           GA+ LAL  E P ++   VD   +A  +A+ N    G++     L S WF S+    FD+
Sbjct: 120 GAIALALASERPAWQVTAVDRVEEAAALAERNRQRLGLANARVRL-SHWFDSLAAERFDL 178

Query: 168 IVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEI 227
           IVSNPPYI +     +  +VR F+P  +L  G DGL   R IA     HL   G   +E 
Sbjct: 179 IVSNPPYIAAEDPHLVAGDVR-FEPSSALVAGADGLDDLRVIAAQAPAHLLPGGWLLLEH 237

Query: 228 GYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           GY+Q   V  +        V +  D GG++R+ L
Sbjct: 238 GYDQAAAVRALLAEHGFIEVASRTDLGGHERITL 271


>gi|332200608|gb|EGJ14680.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Streptococcus pneumoniae GA41317]
          Length = 279

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 120/237 (50%), Gaps = 12/237 (5%)

Query: 28  SVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALA 87
            V  + ++ F+ +   +   H+    I+G  DFY + L +      PRPETE LV+  L 
Sbjct: 46  EVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILT 105

Query: 88  FSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVS 147
            +L        + +LD+GTG+GA+ LAL K  P +     D+S +AL++A  NA    + 
Sbjct: 106 ENL-----ETNLSVLDIGTGSGAIALALAKNRPDWSVTAADVSQEALDLASENAKNQNLQ 160

Query: 148 ERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYR 207
             F   +SD F+ +   +D+IVSNPPYI       +GL V   +P ++L    DGL+ YR
Sbjct: 161 IFFK--KSDCFTEISEKYDIIVSNPPYISREDESEVGLNVLYSEPHLALFADEDGLAIYR 218

Query: 208 TIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF---LVNAFKDYGGNDRVLL 261
            IA+    +L   G   +EIGY Q   V  +F  RK      V   KD  G DR+++
Sbjct: 219 RIAEDAKDYLKDGGKIYLEIGYKQGQSVPELF--RKHLPEKKVRTLKDQFGQDRMVV 273


>gi|297568590|ref|YP_003689934.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924505|gb|ADH85315.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 299

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 134/254 (52%), Gaps = 14/254 (5%)

Query: 17  LSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRP 76
           L++ Q + +P      RQR  L  A+ R    E +  I+G  +F+++   +      PRP
Sbjct: 50  LAAEQPLAEPL-----RQR--LQAALKRRESREPLAYIMGEWEFWSLPFAVGPAVLIPRP 102

Query: 77  ETELLVDSALAF--SLPRIE-KRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKA 133
           ETELLV+ ALAF   L R    R   RILDLGTG+G + + L +E    + V +D S  A
Sbjct: 103 ETELLVEQALAFVRQLQRPPGGRYPWRILDLGTGSGILAVVLAREIASAQVVALDRSPAA 162

Query: 134 LEIAKSNAVTNGVSERFDTLQSDWFSSVEG--LFDVIVSNPPYIESVIVDCLGLEVRDFD 191
           L +A++NA  +GV+E+   + SDW S++     FD++V+NPPY+    +  L  EVR+ +
Sbjct: 163 LAMARANARRHGVAEKITFVGSDWLSALAARPAFDLVVANPPYVCRSAMLTLQPEVREHE 222

Query: 192 PRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLF-LVNAF 250
           P  +LDGG  GL   + I   +   L  DGL  +EIG++QK     +F     +      
Sbjct: 223 PHTALDGGRQGLDDIKIICRDLPAVLRPDGLLLLEIGWDQKTAAAELFNRNPAYRQTEII 282

Query: 251 KDYGGNDRVLLFCR 264
            D  G  RV L CR
Sbjct: 283 NDLAGLPRV-LRCR 295


>gi|264676910|ref|YP_003276816.1| modification methylase, HemK family [Comamonas testosteroni CNB-2]
 gi|262207422|gb|ACY31520.1| modification methylase, HemK family [Comamonas testosteroni CNB-2]
          Length = 291

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 108/213 (50%), Gaps = 11/213 (5%)

Query: 54  ILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCL 113
           + G ++FY + L + S   +PRP+TE LVD AL      + +R  VR++DLGTG+GA+ L
Sbjct: 84  LTGNKEFYGLDLAVDSRVLDPRPDTETLVDWALEL----MPERQPVRVIDLGTGSGAIAL 139

Query: 114 ALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL--FDVIVSN 171
           AL  + P  + + VD S  AL +A+SNA    +  +F      W   ++GL   D+IVSN
Sbjct: 140 ALQSQRPSARVIAVDASADALAVARSNAARLQLPVQF--AHGSWLEPLDGLEPVDLIVSN 197

Query: 172 PPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
           PPYI +   D   L     +P  +L  G DGL   R+I D     L   G    E G++Q
Sbjct: 198 PPYIRA---DDPHLAALTHEPLSALASGADGLEDIRSIIDQAPARLKDGGWLLFEHGWDQ 254

Query: 232 KVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR 264
             DV R+ ++     V    D  G  R    CR
Sbjct: 255 AEDVARLMQAAGFEQVQHRHDLAGIARCTGGCR 287


>gi|218704734|ref|YP_002412253.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli UMN026]
 gi|293404755|ref|ZP_06648747.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli FVEC1412]
 gi|298380398|ref|ZP_06989997.1| HemK protein [Escherichia coli FVEC1302]
 gi|300896600|ref|ZP_07115119.1| protein-(glutamine-N5) methyltransferase [Escherichia coli MS
           198-1]
 gi|218431831|emb|CAR12716.1| N5-glutamine methyltransferase, modifies release factors RF-1 and
           RF-2 [Escherichia coli UMN026]
 gi|291426963|gb|EFE99989.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli FVEC1412]
 gi|298277840|gb|EFI19354.1| HemK protein [Escherichia coli FVEC1302]
 gi|300359543|gb|EFJ75413.1| protein-(glutamine-N5) methyltransferase [Escherichia coli MS
           198-1]
          Length = 277

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVSLAQRNA-QNLAIKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|323964711|gb|EGB60182.1| protein-(glutamine-N5) methyltransferase [Escherichia coli M863]
 gi|327253902|gb|EGE65531.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia coli STEC_7v]
          Length = 277

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 129/258 (50%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQS+WFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAIALAQRNA-QNLAIKNIHILQSNWFSALAGQQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V ++F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQVFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|226525304|gb|ACO70903.1| protein-(glutamine-N5) methyltransferase release factor-specific
           [uncultured Verrucomicrobia bacterium]
          Length = 280

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 130/251 (51%), Gaps = 9/251 (3%)

Query: 10  FLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSS 69
            L  V G    ++ ++ D  L D++   L + + +  + E +  +LG  +F         
Sbjct: 30  LLAHVLGKRRMELYLEFDRPLGDQELNPLRDLVKKRAQGEPLQHLLGTAEFCGRTFGCDR 89

Query: 70  DTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFKGVGV 127
               PRPETE L +  +A      +KR V   RILD+GTG+G + L L    P      V
Sbjct: 90  RALVPRPETEQLCELVVA----EFKKRSVSPRRILDVGTGSGVIALTLAMTWPDAAMEAV 145

Query: 128 DISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEV 187
           D+S +AL +A+ NA   G+++R   ++SD F++VEG FD++V+N PYI+  ++  +  EV
Sbjct: 146 DVSPEALTLARENAARLGLADRIRLVESDLFAAVEGEFDLVVANLPYIDQGVIPTVTREV 205

Query: 188 RDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLV 247
           +  DPR +LDGG  G+  +       ++HL   G+ ++EIG++Q   V  +  +     +
Sbjct: 206 QR-DPRTALDGGEGGMRVFERFIPAATQHLR--GMLALEIGHDQSDPVRALLAAHNYQDI 262

Query: 248 NAFKDYGGNDR 258
               DY G +R
Sbjct: 263 RVVSDYQGRNR 273


>gi|254291409|ref|ZP_04962202.1| hemK protein [Vibrio cholerae AM-19226]
 gi|150422739|gb|EDN14693.1| hemK protein [Vibrio cholerae AM-19226]
          Length = 286

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAALLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLSL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+      L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPHFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|113971502|ref|YP_735295.1| HemK family modification methylase [Shewanella sp. MR-4]
 gi|113886186|gb|ABI40238.1| modification methylase, HemK family [Shewanella sp. MR-4]
          Length = 286

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 127/254 (50%), Gaps = 8/254 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+  FL      S   +   P+  L   Q       + R  +   +  I+G R+F+++  
Sbjct: 28  DAEVFLLYCLNKSRAFLYTWPEKALTVEQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPF 87

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            ++  T  PRP+TE+LV++AL   L         ++LDLGTGTGA+ LAL  E   ++  
Sbjct: 88  IVNDTTLIPRPDTEILVETALNLPL-----ESNAKVLDLGTGTGAIALALASERATWQIT 142

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLG 184
            VD    A+ +AK+N  TN   E+ + LQSDWFS+++   FD+IVSNPPYI+        
Sbjct: 143 AVDKVEDAVALAKANR-TNLKLEQVEILQSDWFSAIKAHDFDLIVSNPPYIDEADEHLHQ 201

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            +VR F+P+ +L    +G +    IA     +L  +G   +E G+ Q V +         
Sbjct: 202 GDVR-FEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLREKLTELGY 260

Query: 245 FLVNAFKDYGGNDR 258
             V   +D+G NDR
Sbjct: 261 QNVATVRDFGSNDR 274


>gi|42519929|ref|NP_965844.1| HemK family modification methylase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42409666|gb|AAS13778.1| modification methylase, HemK family [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 279

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 139/260 (53%), Gaps = 8/260 (3%)

Query: 6   DSHSFLCRVTGLSSHQVIVD-PDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           D    +  V G+    +IV+  D V  +++  F      R+ ++  I +I+G R+F++  
Sbjct: 26  DCEIIMQHVLGVERSFIIVNHADQVPMEKELLFWKLTKKRAERY-PISQIIGNREFWSKN 84

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
             ++    +PRP++E ++ + L +  P   K+  ++I D GTGTG + +++L E  +  G
Sbjct: 85  FIVNQHVLDPRPDSETIILAVLKY-YPN--KKQKLKIADFGTGTGCLLISVLSEYEYAVG 141

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLG 184
           VG + S +A ++A  N   + +  R     S W +   G FD+I+SNPPYI+   +  L 
Sbjct: 142 VGFEKSLEAYKVAYQNTKKHDLLSRAKIFPSSW-TECRGSFDLIISNPPYIKRSKLKDLQ 200

Query: 185 LEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKL 244
            EV+  +PRI+LDGGIDGLS Y +I   + + L K+G   +EIG +Q  ++ +I  S +L
Sbjct: 201 AEVQK-EPRIALDGGIDGLSCYLSIFPILRKCLKKNGFAILEIGEDQS-NIDKIIPSYEL 258

Query: 245 FLVNAFKDYGGNDRVLLFCR 264
                  D  G  R ++  R
Sbjct: 259 AFQEYVYDLAGMKRCIVVKR 278


>gi|316983955|gb|EFV62934.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Neisseria meningitidis H44/76]
          Length = 410

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 114/221 (51%), Gaps = 12/221 (5%)

Query: 44  RSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILD 103
           R L  E +  ILG R+FY  R T++     PRPETE LV++ LA  LP     +  R+ D
Sbjct: 191 RRLNGEPVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA-RLP-----ENGRVWD 244

Query: 104 LGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS--- 160
           LGTG+GAV + +  E P       DIS  ALE A+ NA   G   R +     WF +   
Sbjct: 245 LGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGA--RVEFAHGSWFDTDMP 302

Query: 161 VEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKD 220
            EG +D+IVSNPPYIE+     L  ++R F+P+I+L    DGLS  RT+A G    L + 
Sbjct: 303 SEGKWDIIVSNPPYIENGDKHLLQGDLR-FEPQIALTDFSDGLSCIRTLAQGAPDRLAEG 361

Query: 221 GLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLL 261
           G   +E G++Q   V  +        V    D  G DRV L
Sbjct: 362 GFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRVTL 402


>gi|297618445|ref|YP_003703604.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297146282|gb|ADI03039.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 296

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 137/261 (52%), Gaps = 11/261 (4%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           ++   L  V G+    + V+    ++  +R      I R ++ E +  + G ++F+++  
Sbjct: 29  EAELLLAYVLGIDRVGLYVNYYQPVNQDERSCYREIIKRRVQGEPVAYLTGKKEFFSLEF 88

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGV 125
            +S +   PR ETE++V+ A+A           + + D+GTG GA+ +AL    P  + V
Sbjct: 89  DVSPEVLIPRAETEVMVEKAIAIGR---GMGGSLWVADVGTGCGAIAIALAVYLPNARIV 145

Query: 126 GVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSV---EGLFDVIVSNPPYIESVIVDC 182
            +DIS  A+E+A+ NA    V +R D +  D  + +       D++V+N PY+ +   + 
Sbjct: 146 AIDISSAAVELARKNARRYQVHDRIDFMVGDLLTPLGQDNAGLDIVVANLPYVPTNEWEN 205

Query: 183 LGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESR 242
           L LEV++F+PRI+LDGG DGL++YR +     + L + G   VEI +NQ   ++ + +  
Sbjct: 206 LALEVKEFEPRIALDGGADGLAYYRRLMPQARQCLREGGYILVEIAWNQGPAMLSLMQH- 264

Query: 243 KLFL--VNAFKDYGGNDRVLL 261
             F   V   +D  G DRV++
Sbjct: 265 --FFDEVEVGQDLAGRDRVVV 283


>gi|229513824|ref|ZP_04403286.1| methylase of polypeptide chain release factors [Vibrio cholerae TMA
           21]
 gi|229349005|gb|EEO13962.1| methylase of polypeptide chain release factors [Vibrio cholerae TMA
           21]
          Length = 286

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 128/260 (49%), Gaps = 13/260 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRL 65
           D+   LC V       ++  PD +L+      L   + R    E +  ILG R+F+++ L
Sbjct: 27  DAAVLLCHVLAKPRSYLLTWPDKILEKPTLASLELLLARRRAGEPMAYILGEREFWSLPL 86

Query: 66  TLSSDTFEPRPETELLVDSALAFSLPRIEKRDVV--RILDLGTGTGAVCLALLKESPFFK 123
            +S  T  PRP+TE LV+ AL       +K  ++   +LDLGTGTGA+ LAL  E P  +
Sbjct: 87  KVSPSTLIPRPDTERLVELAL-------DKAALIDGELLDLGTGTGAIALALASELPTRQ 139

Query: 124 GVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVE--GLFDVIVSNPPYIESVIVD 181
             G+D+  +A E+A+ NA    +      LQ  WFS +     F +IVSNPPYIE     
Sbjct: 140 VTGIDLRPEAAELARENATRLAI-HNAQFLQGSWFSPLADGTKFALIVSNPPYIEENDPH 198

Query: 182 CLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFES 241
               +VR F+P+ +L    +GL+  R I+      L   G    E GY+Q V V  I   
Sbjct: 199 LSLGDVR-FEPKSALVAAENGLADIRHISTHAPHFLLDGGWLLFEHGYDQGVAVRTILRD 257

Query: 242 RKLFLVNAFKDYGGNDRVLL 261
                +   +DY G+DRV L
Sbjct: 258 LGYQNIITEQDYAGHDRVTL 277


>gi|293409599|ref|ZP_06653175.1| hypothetical protein ECEG_00538 [Escherichia coli B354]
 gi|331672744|ref|ZP_08373530.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia coli TA280]
 gi|291470067|gb|EFF12551.1| hypothetical protein ECEG_00538 [Escherichia coli B354]
 gi|331069965|gb|EGI41334.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Escherichia coli TA280]
          Length = 277

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 128/258 (49%), Gaps = 8/258 (3%)

Query: 5   RDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVR 64
           RD+   L  VTG     ++   ++ L D Q   L   + R    E I  + G R+F+++ 
Sbjct: 22  RDAEILLEHVTGKGRTFILAFGETQLTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLP 81

Query: 65  LTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG 124
           L +S  T  PRP+TE LV+ ALA  LP        RILDLGTGTGA+ LAL  E P  + 
Sbjct: 82  LFVSPATLIPRPDTECLVEQALA-RLP----EQPCRILDLGTGTGAIALALASERPDCEI 136

Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEG-LFDVIVSNPPYIESVIVDCL 183
             VD    A+ +A+ NA  N   +    LQSDWFS++ G  F +IVSNPPYI+       
Sbjct: 137 TAVDRMPDAVSLAQRNA-QNLAIKNIHILQSDWFSALAGHQFAMIVSNPPYIDEQDPHLQ 195

Query: 184 GLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRK 243
             +VR F+P  +L     G++    I +     L   G   +E G+ Q   V + F    
Sbjct: 196 QGDVR-FEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAG 254

Query: 244 LFLVNAFKDYGGNDRVLL 261
              V   +DYG N+RV L
Sbjct: 255 YHDVETCRDYGDNERVTL 272


>gi|324994441|gb|EGC26354.1| protein-(glutamine-N5) methyltransferase [Streptococcus sanguinis
           SK678]
          Length = 276

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 113/216 (52%), Gaps = 8/216 (3%)

Query: 46  LKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLG 105
           L H+    I+G  DF+ + L +      PRPETE LV+  L+ +         + +LD+G
Sbjct: 63  LAHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSEN-----PESSLSVLDIG 117

Query: 106 TGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLF 165
           TG+GA+ LAL    P ++    D+S  AL +A  NA + G++  F  +QSD   ++ G F
Sbjct: 118 TGSGAIALALANSRPNWQITASDLSDDALALAAENAQSCGLNLAF--VQSDCLDAISGNF 175

Query: 166 DVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSV 225
           D+IVSNPPYI     D +GL V   +P ++L    DG + YR IA+    +L K G   +
Sbjct: 176 DIIVSNPPYISEADKDEVGLNVLTSEPHMALFAEEDGYAVYRKIAEQAGDYLTKKGKIYL 235

Query: 226 EIGYNQKVDVVRIFESR-KLFLVNAFKDYGGNDRVL 260
           EIGY Q   +  + E       +   KD  G DR++
Sbjct: 236 EIGYKQGDGIRELLEKNFPQKRIRVLKDQFGKDRMV 271


>gi|115350467|ref|YP_772306.1| HemK family modification methylase [Burkholderia ambifaria AMMD]
 gi|115280455|gb|ABI85972.1| [protein release factor]-glutamine N5-methyltransferase
           [Burkholderia ambifaria AMMD]
          Length = 280

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 131/262 (50%), Gaps = 15/262 (5%)

Query: 6   DSHSFLCRVTGLSSHQVIVDPDSVLDDR--QRFFLTNAIVRSLKHESIHRILGWRDFYNV 63
           D+   L    G +  Q+I   D+ L+    +R+    A  R +  E + +++G R+F+  
Sbjct: 19  DARVLLAHALGWTRTQLITRGDAPLEPASIERYRALEA--RRVAGEPVAQLVGMREFFGR 76

Query: 64  RLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFK 123
              ++ D   PRPETELLV++AL      I+ R    +LDLGTG+GA+ +++  E P  +
Sbjct: 77  PFDVTPDVLIPRPETELLVEAALDA----IDGRPHPAVLDLGTGSGAIAVSIAAERPDAR 132

Query: 124 GVGVDISCKALEIAKSNAVTNGVSER----FDTLQSDWFSSVEGL--FDVIVSNPPYIES 177
              +D S  AL++A+ NA     + R       LQSDW+++++    FD IVSNPPYI  
Sbjct: 133 VWALDRSPAALDVARRNADKLLDARRPGGPLHWLQSDWYAALDPALAFDTIVSNPPYIAQ 192

Query: 178 VIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVR 237
                   ++R F+PR +L    DGLS  RTI  G    L   G   +E GY+Q   V  
Sbjct: 193 HDPHLAQGDLR-FEPRGALTDDADGLSAIRTIVAGAGAFLKPGGTLWIEHGYDQAEAVRA 251

Query: 238 IFESRKLFLVNAFKDYGGNDRV 259
           +  SR    V +  D    +R 
Sbjct: 252 LLVSRGFVAVESLADLAAIERT 273


>gi|85375681|ref|YP_459743.1| protein chain release factor methylase subunit [Erythrobacter
           litoralis HTCC2594]
 gi|84788764|gb|ABC64946.1| protein chain release factor methylase subunit [Erythrobacter
           litoralis HTCC2594]
          Length = 283

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Posi