RPSBLAST alignment for GI: 254780875 and conserved domain: TIGR03533

>gnl|CDD|163310 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific. Members of this protein family methylate ribosomal protein L3 on a glutamine side chain. This family is related to HemK, a protein-glutamine methyltranferase for peptide chain release factors. Length = 284
 Score =  108 bits (273), Expect = 1e-24
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 11/162 (6%)

Query: 74  PR-PETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKG--VGVDIS 130
           PR P  EL+ +   A   P +E   V RILDL TG+G  C+A+     F +     VDIS
Sbjct: 101 PRSPIAELI-EDGFA---PWLEPEPVKRILDLCTGSG--CIAIACAYAFPEAEVDAVDIS 154

Query: 131 CKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGL-FDVIVSNPPYIESVIVDCLGLEVRD 189
             AL +A+ N   +G+ +R   +QSD F+++ G  +D+IVSNPPY+++  +  L  E   
Sbjct: 155 PDALAVAEINIERHGLEDRVTLIQSDLFAALPGRKYDLIVSNPPYVDAEDMADLPAEYH- 213

Query: 190 FDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQ 231
            +P ++L  G DGL   R I    + HLN++G+  VE+G + 
Sbjct: 214 HEPELALASGEDGLDLVRRILAEAADHLNENGVLVVEVGNSM 255