RPSBLAST alignment for GI: 254780875 and conserved domain: COG1092

>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only]. Length = 393
 Score = 41.5 bits (97), Expect = 2e-04
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 100 RILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSE-RFDTLQSDWF 158
           R+L+L + TG   +         +   VD+S +ALE A+ NA  NG+   R   +  D F
Sbjct: 220 RVLNLFSYTGGFSVHAALGGAS-EVTSVDLSKRALEWARENAELNGLDGDRHRFIVGDVF 278

Query: 159 SSVEGL------FDVIVSNPP 173
             +         FD+I+ +PP
Sbjct: 279 KWLRKAERRGEKFDLIILDPP 299