RPSBLAST alignment for GI: 254780875 and conserved domain: COG2226

>gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]. Length = 238
 Score = 40.6 bits (95), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 81  LVDSALAFSLPRIEKRDVV---------RILDLGTGTGAVCLALLKESPFFKGVGVDISC 131
           L++  ++F L R+ +R ++         ++LD+  GTG + L L K     + VG+DIS 
Sbjct: 26  LMNDLMSFGLHRLWRRALISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDISE 85

Query: 132 KALEIAKSNAVTNGVS 147
             LE+A+      GV 
Sbjct: 86  SMLEVAREKLKKKGVQ 101