RPSBLAST alignment for GI: 254780875 and conserved domain: COG2264

>gnl|CDD|32445 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]. Length = 300
 Score = 51.4 bits (123), Expect = 3e-07
 Identities = 55/178 (30%), Positives = 75/178 (42%), Gaps = 30/178 (16%)

Query: 69  SDTFEPRPETELLV--DSALAF----------SLPRIEKRD--VVRILDLGTGTGAVCLA 114
           S    P P  EL +  D  LAF           L  +EK       +LD+G G+G + +A
Sbjct: 120 SWREYPEPSDELNIELDPGLAFGTGTHPTTSLCLEALEKLLKKGKTVLDVGCGSGILAIA 179

Query: 115 LLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSS----VEGLFDVIVS 170
             K     K VGVDI  +A+E A+ NA  NGV      +Q+  F        G FDVIV+
Sbjct: 180 AAKLGAK-KVVGVDIDPQAVEAARENARLNGVELL---VQAKGFLLLEVPENGPFDVIVA 235

Query: 171 NPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSH-YRTIADGVSRHLNKDGLCSVEI 227
           N   +  V+V+      R   P     GG   LS      A+ V+    + G   VE+
Sbjct: 236 N--ILAEVLVELAPDIKRLLKP-----GGRLILSGILEDQAESVAEAYEQAGFEVVEV 286