RPSBLAST alignment for GI: 254780875 and conserved domain: KOG2904

>gnl|CDD|38115 KOG2904, KOG2904, KOG2904, Predicted methyltransferase [General function prediction only]. Length = 328
 Score =  122 bits (307), Expect = 1e-28
 Identities = 75/250 (30%), Positives = 118/250 (47%), Gaps = 13/250 (5%)

Query: 27  DSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSAL 86
           D  L   Q   +  A ++  K   +  ILG + F ++ L        PRPETE  V++ +
Sbjct: 79  DDPLVILQLESIRWACLQRYKRMPLQYILGSQPFGDLDLVCKPGVLIPRPETEEWVEAVI 138

Query: 87  AFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGV 146
             +L   E      ILDLGTG+GA+ L+LL   P      +D+S  A+++AK NA    +
Sbjct: 139 D-ALNNSEHSKHTHILDLGTGSGAISLSLLHGLPQCTVTAIDVSKAAIKLAKENAQRLKL 197

Query: 147 SERFD----TLQSDWF---SSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGG 199
           S R +     ++SD       +EG  D++VSNPPYI       L  EVR ++P+++LDGG
Sbjct: 198 SGRIEVIHNIMESDASDEHPLLEGKIDLLVSNPPYIRKDDNRQLKPEVRLYEPKLALDGG 257

Query: 200 IDGLSHYRTIADGVSRHLNKDGLCSVE-IGYNQKVDVVRIFESRKLFLVNAF----KDYG 254
           ++G  +        +R L   G   +E +   +   +VRI+        N       D+ 
Sbjct: 258 LEGYDNLVHYWLLATRMLQPGGFEQLELVERKEHSYLVRIWMISLKDDSNGKAAVVSDFA 317

Query: 255 GNDRVLLFCR 264
           G  R ++  R
Sbjct: 318 GRPRFVIIHR 327