BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus Liberibacter asiaticus str. psy62] (264 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 532 bits (1370), Expect = e-153, Method: Compositional matrix adjust. Identities = 264/264 (100%), Positives = 264/264 (100%) Query: 1 MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60 MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF Sbjct: 1 MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60 Query: 61 YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120 YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP Sbjct: 61 YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120 Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV Sbjct: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180 Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE Sbjct: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240 Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264 SRKLFLVNAFKDYGGNDRVLLFCR Sbjct: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264 >gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 26.6 bits (57), Expect = 0.46, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 202 GLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGN 256 G S R +S+ + DGL ++ N++ D +RIFE K FK+Y + Sbjct: 44 GYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEK----QTFKEYNSD 94 >gi|254781210|ref|YP_003065623.1| hypothetical protein CLIBASIA_05585 [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 25.8 bits (55), Expect = 0.85, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 20/42 (47%) Query: 191 DPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQK 232 DP +LD GI+ L Y ++A + + +G N+K Sbjct: 89 DPFATLDSGINPLLPYASLATAAMHRKQDEAILKGMLGVNKK 130 >gi|254780456|ref|YP_003064869.1| 30S ribosomal protein S1 [Candidatus Liberibacter asiaticus str. psy62] Length = 576 Score = 25.4 bits (54), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 14/89 (15%) Query: 174 YIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKV 233 Y+E V + + D+ + L GI+GL+H I+ ++++ + SV Q+V Sbjct: 280 YVEGSKVSGVVTNLTDYGVFVELQSGIEGLAHISQIS-WTKKNIHPSKILSV----GQQV 334 Query: 234 DVV---------RIFESRKLFLVNAFKDY 253 +VV RI K L+N ++++ Sbjct: 335 EVVILEVNPARKRISLGLKQALINPWEEF 363 >gi|254780974|ref|YP_003065387.1| adenylosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 435 Score = 22.7 bits (47), Expect = 5.9, Method: Compositional matrix adjust. Identities = 15/68 (22%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Query: 173 PYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQK 232 PY+E + D +GL+ DP S D + Y ++ ++ + + + EI + Q+ Sbjct: 195 PYVEQHVADAMGLKT---DPISSQVIARDRHAMYFSVLGVIASSIER---VATEIRHLQR 248 Query: 233 VDVVRIFE 240 +++ + E Sbjct: 249 TEILEVEE 256 >gi|254780872|ref|YP_003065285.1| 3-demethylubiquinone-9 3-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 22.7 bits (47), Expect = 6.7, Method: Compositional matrix adjust. Identities = 11/46 (23%), Positives = 25/46 (54%) Query: 125 VGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVS 170 G+D S K + IAK++A ++ + ++ + + FD+I++ Sbjct: 92 TGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILN 137 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.141 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 175,326 Number of Sequences: 1233 Number of extensions: 7612 Number of successful extensions: 15 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 7 length of query: 264 length of database: 328,796 effective HSP length: 72 effective length of query: 192 effective length of database: 240,020 effective search space: 46083840 effective search space used: 46083840 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 37 (18.9 bits)