RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics, PSI-2, protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans UA159} (A:1-132) Length = 132 Score = 26.8 bits (59), Expect = 2.2 Identities = 4/35 (11%), Positives = 7/35 (20%) Query: 49 HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83 A+ G + + A R Sbjct: 67 EHADYLEDEVERVKKVGYRDLISHLYFSACFSIRA 101 >1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit; electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} (A:242-472) Length = 231 Score = 25.8 bits (55), Expect = 4.3 Identities = 13/134 (9%), Positives = 34/134 (25%), Gaps = 2/134 (1%) Query: 51 AERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKE 110 M + A N V + + + ++ + ++ +E+ Sbjct: 59 PGHTPDSVIKQMQKDTGMGAWNLYAALYGTQEQVDVNWKIVTDVFKKLGKGRIVTQEEAG 118 Query: 111 RAQ--NALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRR 168 Q ++ + L E G V+ +++ K+V + Sbjct: 119 DTQPFKYRAQLMSGVPNLQEFGLYNWRGGGGSMWFAPVSEARGSECKKQAAMAKRVLHKY 178 Query: 169 PLRPRVFPNAKSGN 182 L + Sbjct: 179 GLDYVAEFIVAPRD 192 >1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} (A:) Length = 70 Score = 25.3 bits (56), Expect = 5.6 Identities = 12/45 (26%), Positives = 25/45 (55%) Query: 77 AEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEA 121 E ++ + +A ++E L+ + D+ V+ +ERA+NAL+ Sbjct: 24 EEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQ 68 >3i4l_A A-type ATP synthase catalytic subunit A; hydrolase; HET: ANP; 2.40A {Pyrococcus horikoshii} PDB: 3i72_A 3i73_A* 3ikj_A 1vdz_A (A:1-101,A:190-440) Length = 352 Score = 24.7 bits (53), Expect = 9.2 Identities = 4/19 (21%), Positives = 5/19 (26%) Query: 124 CPLIEEGKEPIFENSIQPK 142 P + G I K Sbjct: 134 FPQAKGGTAAIPGPFGSGK 152 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.312 0.128 0.356 Gapped Lambda K H 0.267 0.0677 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,472,551 Number of extensions: 62747 Number of successful extensions: 143 Number of sequences better than 10.0: 1 Number of HSP's gapped: 143 Number of HSP's successfully gapped: 14 Length of query: 210 Length of database: 4,956,049 Length adjustment: 85 Effective length of query: 125 Effective length of database: 2,082,624 Effective search space: 260328000 Effective search space used: 260328000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (23.9 bits)