RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]} Length = 68 Score = 28.8 bits (65), Expect = 0.34 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Query: 66 DYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSE 118 D A + E ++ + +A ++E L+ + D+ V+ +ERA+NAL+ Sbjct: 15 DEDFA--TVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALAT 65 >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Score = 28.4 bits (62), Expect = 0.52 Identities = 7/35 (20%), Positives = 12/35 (34%) Query: 49 HIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRI 83 +A Y A ++ G + A L A + Sbjct: 40 SLANEYEQEAERKVALGHDLSAGELLMSAALCAQY 74 >d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Length = 373 Score = 27.3 bits (60), Expect = 1.1 Identities = 5/64 (7%), Positives = 13/64 (20%) Query: 9 RSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYV 68 G +R + + T A + + + D Sbjct: 212 WKCHNDPIIQMGWTSRDISGVTIDTLNVIHTRYIKSETVVPSAIIGASPFYASGMSPDSR 271 Query: 69 VAEN 72 + + Sbjct: 272 KSIS 275 >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Score = 26.8 bits (57), Expect = 1.4 Identities = 14/76 (18%), Positives = 29/76 (38%), Gaps = 6/76 (7%) Query: 49 HIAERYSVLARDAMSAGDYVVAENHLQHA------EHYNRIVSMAQAQIQEKLQRDEQDD 102 + +L + AG A+ L A + + + ++L++ Q + Sbjct: 289 DLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQLIQLN 348 Query: 103 LLVKEQKERAQNALSE 118 L + ++ RAQ L E Sbjct: 349 TLPELEQHRAQRILRE 364 >d2ha9a1 c.7.1.5 (A:1-440) Uncharacterized protein SP0239 {Streptococcus pneumoniae [TaxId: 1313]} Length = 440 Score = 24.7 bits (54), Expect = 6.8 Identities = 6/25 (24%), Positives = 9/25 (36%) Query: 157 KDVSYKKVRRRRPLRPRVFPNAKSG 181 D + V + R+ P K G Sbjct: 380 ADEAAIGVINMKTTAVRIIPKGKEG 404 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.312 0.128 0.356 Gapped Lambda K H 0.267 0.0686 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 713,160 Number of extensions: 31627 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 10 Length of query: 210 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 129 Effective length of database: 1,295,466 Effective search space: 167115114 Effective search space used: 167115114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.5 bits)