HHsearch alignment for GI: 254780877 and conserved domain: COG0703

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism].
Probab=95.52  E-value=0.26  Score=29.68  Aligned_cols=70  Identities=27%  Similarity=0.395  Sum_probs=41.9

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHCC--CCCHHHCCCEEEEEEHHHHHCCCCCCCH--HHHHHHHHHHHHHHCCCCEE
Q ss_conf             7866895288740777999999987348--9984445743788731354217454202--45458999999860799769
Q gi|254780877|r  199 KNNPVLIGDPGVGKTAIIEGLASRIING--DIPESLKGKRLMALDMGALIAGAKFRGE--FEERLKSLLCEIRSEDGEII  274 (853)
Q Consensus       199 k~n~~lvGe~GvGKtaive~la~~i~~~--~vp~~l~~~~i~~ld~~~l~ag~~~rg~--~e~r~~~i~~~~~~~~~~~i  274 (853)
T Consensus         2 ~~~IvLiG~mGaGKSTIGr~LAk~L~~~F~D~D~~Ie--~~~g~sI~eIF~~---~GE~~FR~~E~~vl~~l~~~~-~~V   75 (172)
T COG0703           2 NMNIVLIGFMGAGKSTIGRALAKALNLPFIDTDQEIE--KRTGMSIAEIFEE---EGEEGFRRLETEVLKELLEED-NAV   75 (172)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCCCCCCCHHHHH--HHHCCCHHHHHHH---HHHHHHHHHHHHHHHHHHHCC-CEE
T ss_conf             9618997179997768999999981998022469999--9979699999999---828999999999999986269-959