HHsearch alignment for GI: 254780877 and conserved domain: PRK08769

>PRK08769 DNA polymerase III subunit delta'; Validated.
Probab=97.99  E-value=0.001  Score=49.19  Aligned_cols=150  Identities=22%  Similarity=0.301  Sum_probs=91.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHCCCCCCCHHH--CCC
Q ss_conf             489999999999874101236566512898726786168899999998723776530022447740345320130--477
Q gi|254780877|r  573 QSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLI--GSP  650 (853)
Q Consensus       573 q~~ai~~v~~~~~~~~~gl~~~~~p~~~flf~GptGvGKTelak~la~~lf~~~~~lir~dMsey~e~~~vs~Li--Gap  650 (853)
T Consensus         9 q~~~~~~L~~~i~~~rl-------~H-A~Lf~Gp~G~GK~~~A~~~A~~llc~~~~~~--------~~~~~~~~i~~g~H   72 (319)
T PRK08769          9 QQRAFDQTVAALDAGRL-------GH-GLLICGPEGLGKRAVALALAEHVLASGPDPA--------LAQRTRQLIAAGTH   72 (319)
T ss_pred             CHHHHHHHHHHHHCCCC-------CC-EEEEECCCCCCHHHHHHHHHHHHHCCCCCCC--------CCCHHHHHHHCCCC
T ss_conf             68999999999976994-------20-6875899987899999999999837997976--------54338899966899


Q ss_pred             CHHCCC----CCCC------CCCHHHH-------CCC----CCEEEEHHHHHCCHHHHHHHHHHHHCCEEECCCCCEEEC
Q ss_conf             112035----6677------4211322-------156----410220214414989999999984045788799977830
Q gi|254780877|r  651 PGYVGY----EEGG------ALTEAVR-------RHP----YQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDF  709 (853)
Q Consensus       651 pGYvG~----~~gg------~Lte~vr-------~~P----~sVil~DEiEKah~~v~~~llqild~G~ltd~~G~~v~f  709 (853)
T Consensus        73 PD~~~i~~~~~~~~~k~k~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~mn~~AaNalLK~LEEPp-----------  141 (319)
T PRK08769         73 PDLQLVSFIPNRTGDKLRTEIVIEQVREISQKLALTPQYGIAQVVIVDPADAINRSACNALLKTLEEPS-----------  141 (319)
T ss_pred             CCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHCCHHHHHHHHHHHCCCC-----------
T ss_conf             896877534444543112348699999999996137202795699980667528999999999822799-----------


Q ss_pred             CCCEEEECCCHHHHHHHCCHHHHHHHHHHHHHHHCCHHHHCCCCCEEECCCCCHHHHHHHH
Q ss_conf             3315595485126876403267999999999862885772666815862889989999999
Q gi|254780877|r  710 RNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIV  770 (853)
Q Consensus       710 ~n~iii~TsN~G~~~~~~~~~~~~~~~~~~l~~~f~peflnRid~iv~F~~l~~~~~~~i~  770 (853)
T Consensus       142 ~~~~~iL~~~~~~~--------------------ll~TI~SRC-q~~~~~~p~~~~~~~~L  181 (319)
T PRK08769        142 PGRYLWLISAQPAR--------------------LPATIRSRC-QRLEFKLPPAHEALAWL  181 (319)
T ss_pred             CCEEEEEEECCHHH--------------------CCHHHHHCC-EEECCCCCCHHHHHHHH
T ss_conf             88489998699365--------------------824776485-01118996999999999