HHsearch alignment for GI: 254780877 and conserved domain: PRK11823

>PRK11823 DNA repair protein RadA; Provisional.
Probab=96.66  E-value=0.0033  Score=44.99  Aligned_cols=187  Identities=21%  Similarity=0.360  Sum_probs=114.0

Q ss_pred             HHHHHHHHHHHCCC--CCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEEEHHHHHCCCCCCCH-------
Q ss_conf             78999999963367--778668952887407779999999873489984445743788731354217454202-------
Q gi|254780877|r  184 DDEMRRAIQVLSRR--TKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGE-------  254 (853)
Q Consensus       184 e~EI~~~~~iL~r~--~k~n~~lvGe~GvGKtaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-------  254 (853)
T Consensus        76 i~ElDRV---LGGGlV~GS~iLlgGePGIGKSTLlLQ~a~~la~~--------~~vLYvSGEES~~Qik~RA~RLg~~~~  144 (454)
T PRK11823         76 IGELDRV---LGGGLVPGSVVLIGGDPGIGKSTLLLQVAAALAAG--------GKVLYVSGEESLQQIKLRAERLGLPSD  144 (454)
T ss_pred             CHHHHHC---CCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCC--------CCEEEECCCHHHHHHHHHHHHHCCCCC
T ss_conf             5566522---15872066489950799888999999999998559--------957998150157899999997588888


Q ss_pred             -----HHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCC--CCCCCCC-----HHHHHHHHHCCCC-EEEEEEECHHHHHH
Q ss_conf             -----454589999998607997699963627730266--6554335-----8888765312466-04899744899999
Q gi|254780877|r  255 -----FEERLKSLLCEIRSEDGEIILFIDELHVLVGAG--KTDGAMD-----ASNLLKPSLARGE-LHCIGATTLDEYRK  321 (853)
Q Consensus       255 -----~e~r~~~i~~~~~~~~~~~ilfide~h~~~gaG--~~~g~~D-----aan~LKP~LarG~-l~~IgaTT~~Eyrk  321 (853)
T Consensus       145 ~l~l~~et~l~~Il~~i~~~~-P~~lIIDSIQT~~~~~~~s~pGsvsQVre~a~~L~~~AK~~~i~~~lVGHVTKdG---  220 (454)
T PRK11823        145 NLYLLAETNLEDILATIEEEK-PDLVVIDSIQTMYSPELESAPGSVSQVRECAAELTRLAKQSGIAVFLVGHVTKEG---  220 (454)
T ss_pred             CCEEEECCCHHHHHHHHHHHC-CCEEEEECHHEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC---
T ss_conf             737885368999999998609-9889994311154156677899789999999999999974498289999772677---


Q ss_pred             HHHCCHHHHHCCCEEECCCCCHHHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHCCCCC
Q ss_conf             7300111320231111157776789999999789865414961---015899999863332024576
Q gi|254780877|r  322 YIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVR---ISDSALVSAAVLSNRYITDRF  385 (853)
Q Consensus       322 ~iEkD~Al~RRFq~i~V~Eps~~~t~~iL~gl~~~yE~~H~V~---i~d~al~~av~ls~rYi~~r~  385 (853)
T Consensus       221 ~iAGPkvLEHmVDtVl~fEGd~~~~~RiLR~~KNRFG~t~EiGvFeM~~~GL~~v~nPS~~Fls~~~  287 (454)
T PRK11823        221 AIAGPRVLEHMVDTVLYFEGDRHSRFRILRAVKNRFGATNEIGVFEMTEKGLREVSNPSELFLSERD  287 (454)
T ss_pred             CCCCCHHHHHHHCEEEEECCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCEECCCHHHHHHHCCC
T ss_conf             6466145222010468751576655024563124677666058998616884566887799862688